KEGG   Alligator sinensis (Chinese alligator): 102374609Help
Entry
102374609         CDS       T02922                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:asn01002]
    102374609 (TMPRSS9)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102374609 (TMPRSS9)
Peptidases [BR:asn01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102374609 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 102374609
NCBI-ProteinID: XP_025048848
UniProt: A0A1U8DVP4
LinkDB All DBs
Position
Unknown
AA seq 1069 aa AA seqDB search
MEQMDVALKPVPSTERVKLAAFSICCKVTVAIVFVGGIAGLSFMILLACHPRRELSFEHT
VELRGIVYDNSLQRETSDYYRMLTPTLERLVSWNLPTSQPLSSSLEEEALTRGLTEALNK
QGIPLATYGTISSAFLTINHLFPVRLGSCPGNTFACKNSQCVWKENPECDGHADCLDASD
EADCDCGSRPAMQTANRIVGGSKASRGEFPWQVSLRENNEHFCGAAILTEKWLVSAAHCF
NEFQDPKVWAAYAGTTSLSGIDPSTVKAGIAQIITHPSYNADTADFDVAVLELASPMAFN
KYIQPVCLPGAGHHFPAGKKCLISGWGYLKEDFLVKPETLQKATVELLDQVLCSSLYSYA
LTDRMVCAGYLEGKIDSCQGDSGGPLVCEEPSGKFFLAGIVSWGIGCAEARRPGVYARVT
KLRDWILDAVSASPAFTALTLPETPSSTNSSSATTEGISNSITSTPRAISTISSTPATSK
SATTARPQGIVPLQWSISLTSFNECGGRPGLSKPNKIVGGFNASRGEIPWQVSLKEGSRH
FCGATVVGERWLLSAAHCFNQTKLEYIKAYIGTTSLNGADGNTVKVSIKKVVQHPSYNPI
ILDFDVAVLELASPLLFNKYIQPVCLPLAVQKFPVGKKCMISGWGNIQEGNITKPESLQK
ASVGIIDQKTCNVLYNFSLTDRMICAGFLEGKVDSCQGDSGGPLACEETPGVFYLAGIVS
WGIGCAQAKKPGVYSRITKLKDWILDIISPLPAPEAGTSPSPATTRACTTTSSTAWISTS
TSKAATSPADRTTSKAAATTSTTTRKATAAVPKTSGPAKPTQLPDCGMTPAVAFNKIVGG
SAAARGEWPWQVSLWLRRKEHKCGAVLIAEKWLLSAAHCFDVYSDPKMWVAFLGTPFLTD
IDGRVEKIYRIYKHPFYNVYTLDYDVALLELTTPMKYTSTIKPICLPDNSHMFREGSRCF
ITGWGSTKEGGFMSKQLQKAAVNVIGDQACKKFYPIQISSRMVCAGFPQGTVDSCSGDAG
GPLACKEPSGRWFLAGITSWGYGCARPYFPGVYTKVTAVRGWIAQNLKL
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaatggatgtagctctaaagccagtgccaagcacagagagggtgaaattggca
gctttcagcatatgctgtaaggtaaccgttgctatcgtatttgtgggtggcattgctggc
ctatccttcatgatcctattggcctgtcatcctagacgagagctcagctttgagcacact
gtggagctaagaggaatcgtgtatgacaacagcttacaaagggagacatcggactactac
cgaatgctgacccccactctggaaaggctggtgagttggaacctgcccacttcccaacct
ttgagctccagcttggaggaagaggcactcacacgtgggctaacagaagcactgaacaaa
cagggtatccctctggctacctatgggactatatcctcagcctttctcacaattaaccat
ctctttcctgttcgtctaggcagttgccctggaaatacatttgcttgtaagaacagccag
tgtgtatggaaagagaacccagagtgtgatggccacgctgactgcttggatgcctctgat
gaggcagactgtgactgtgggagtcgacccgccatgcagacagccaacaggattgtggga
ggctccaaagcctccagaggggagtttccatggcaagtcagcctgagggaaaacaacgag
catttctgtggtgcagccatcctcactgagaagtggctggtgtctgctgctcactgcttt
aatgagtttcaggacccaaaggtctgggctgcctatgcaggaaccacctctctcagtggc
atcgaccccagcactgtgaaagctggcattgcacagataatcacacacccttcttataat
gcggatactgctgattttgacgtggctgtgctggagcttgcaagtcctatggcctttaac
aagtacatccagcccgtgtgcctaccaggagctgggcaccacttccctgctggcaagaaa
tgtctcatctctggctggggctaccttaaggaagactttttggtaaaaccagagaccttg
cagaaggcgacagtggagctgctggaccaggtgttgtgctctagcctgtatagctatgcc
ctcactgacaggatggtgtgcgctggctacttggaggggaaaattgattcatgccagggt
gactctggtggccccctggtttgtgaagaaccatctggcaagtttttcctagcaggcatc
gtgagctggggaatcggctgtgctgaagccaggcgaccaggagtttatgcccgagtgaca
aagctcagagactggatccttgatgctgtctctgcctcccctgccttcacagcactcacc
ctcccagaaacaccttctagcacaaacagcagttctgccaccactgaagggatcagcaac
agcatcaccagcactcctagagctatctccactatctcctcaaccccagccaccagcaag
tcagctaccactgccaggcctcaaggtattgtgcccctacaatggtcaatctctctgact
agtttcaatgaatgtggtggacgacctggtctctctaaacccaacaagattgtgggagga
ttcaatgcttccagaggagagatcccctggcaagtcagcctgaaggaagggtcgagacat
ttctgtggagccaccgtcgttggagagcgctggctcctgtcagcagctcactgtttcaat
cagacaaagctggaatatatcaaagcctacataggaaccacatcattaaatggagcagat
ggcaacacagtgaaagtcagtataaagaaagtggtgcagcacccttcctacaatcctatc
atcctggactttgatgttgctgtattagaactggcaagtcccctgctcttcaacaaatac
atccagcctgtgtgtctccctctagctgtgcagaagttccctgttggcaagaagtgcatg
atttctggatggggaaatatccaagaaggcaacatcaccaagcctgaaagcctgcagaaa
gcctctgttggcatcattgatcagaagacctgcaacgtcctctacaacttttcccttact
gacaggatgatctgtgctggcttcctagaagggaaggtcgactcatgccagggggactca
gggggaccactggcctgcgaggagaccccaggtgtgttttatctggctggcattgtgagc
tggggaattggttgtgcccaagccaagaagccaggggtgtactccaggataaccaagctt
aaagactggatcctcgacatcatctcacccttgcctgcccctgaagcaggcacctcaccc
agcccagccactacaagagcttgcaccacaaccagctccacagcctggatcagcaccagc
accagcaaagcagctacaagcccagctgacaggacaaccagcaaagcagcagccaccact
agcaccaccaccaggaaagcaactgctgctgttccaaagacaagtggtcctgccaaacct
acccagctgccagattgtggcatgactcctgctgtagccttcaataagattgtcggcgga
agtgctgcagctcggggtgagtggccctggcaggtcagtctctggcttcggcgaaaggag
cacaagtgtggagccgtcctcatcgctgaaaagtggctactttcagcagctcattgcttt
gatgtctacagtgaccccaagatgtgggtggcctttctggggacacctttcctgaccgac
attgatgggagggtggagaaaatctaccgcatctacaagcacccattctacaatgtttac
accctggactacgatgtggcactgttggagctaactacgcctatgaaatacaccagcacc
atcaaacccatctgtctcccagacaactctcatatgttccgggaaggctcaagatgcttc
atcacaggctggggctccaccaaggaaggaggctttatgtccaaacaactgcaaaaagca
gccgtaaatgtaattggtgatcaggcctgcaagaagttttaccccatccagatcagcagc
aggatggtgtgtgctggctttccacagggcactgtcgacagctgttcgggcgatgcaggt
ggccccttggcatgcaaggaaccttcaggaagatggtttctcgctggaatcacaagctgg
ggctatggctgtgcaaggccatacttccctggtgtttacaccaaagtaacagctgtccgg
ggctggattgcacagaacctcaagctgtaa

DBGET integrated database retrieval system