KEGG   Alligator sinensis (Chinese alligator): 102374662
Entry
102374662         CDS       T02922                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04010  MAPK signaling pathway
asn04210  Apoptosis
asn04620  Toll-like receptor signaling pathway
asn04621  NOD-like receptor signaling pathway
asn04622  RIG-I-like receptor signaling pathway
asn04623  Cytosolic DNA-sensing pathway
asn04625  C-type lectin receptor signaling pathway
asn04920  Adipocytokine signaling pathway
asn05132  Salmonella infection
asn05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102374662 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102374662 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102374662 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102374662 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102374662 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102374662 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102374662 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102374662 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102374662 (IKBKG)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102374662 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:asn01001]
    102374662 (IKBKG)
Protein kinases [BR:asn01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102374662 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 NEMO Fez1 AnfG_VnfG zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 102374662
NCBI-ProteinID: XP_006029398
UniProt: A0A1U7S552
LinkDB
Position
Unknown
AA seq 534 aa
MTDTEAEVPDYGALNSRRPFPTSFRLRVVLDLKEALRQGNQALRLRCQEFQQVQAMRREE
HDFLLLRFHEARTLVQQLQNEQLEVRRQLEWLRSTCQPPSLLCTLEPAGLDEADTVTLTH
ETPVALMALDRSKENQAVLKEADTLLLGEKPLHNQTQQQRLLVKESGALAEQLLKTESLQ
GAGNNRIRDDQAEELHRKLEETENKCAELKQQLASAREDLSQLEAQGQETEQQFQALRKQ
LEQVTEDRVSVKAQVTSLLGELQESQSRLETCMHEKQALEERARTAVEQCRRLEGDVEAL
QEQHGVQLDQLRLQAQNLETALRVERQGATEEKRKLAQLQVAYHQLFQEYDSHIKNSIEG
EKRAQALEWQLDELSQQLQQAEEALVAKQELIDKLKEEAEHHRAVLETIPVLKAQADIYK
ADFLAERQAREQLHGQREDLQEQLVTLQRDYEVLKADAAGTTRALMEEMRNRHSEVRPPL
PVPPTAYPLAVGPYQAAPHQGSISEEQPDFCCPKCQYQAPDMDTLQIHVMDCIK
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgacagataccgaggcggaagttcccgactatggtgcgttgaactcccgacgccccttc
ccaacttccttccggctccgggtcgtcttagacctcaaggaggctctgcggcagggcaac
caagcgctacggctgcgatgccaggagttccagcaagttcaggccatgcggcgtgaggag
catgacttccttctgctgcgcttccatgaggcccgcaccctggtgcagcagctgcagaat
gaacagctggaggtgcggcgacagcttgagtggttgcgcagcacctgccagcctccatcc
ttgctatgcaccctggagccagctgggctggatgaggctgacaccgtgactctcacccat
gagacgcctgtagcgctgatggctcttgaccgtagcaaggagaaccaggcagtgctgaag
gaagcagacaccctcctgttgggagagaagccactgcataaccagacccagcagcagagg
ctgctggtcaaggagagcggtgccctagctgagcagctcctgaagactgaatccttgcaa
ggggctgggaacaacaggatcagagatgaccaggctgaggagctgcacaggaagctagag
gaaacagaaaacaagtgtgctgagctgaagcagcagctggcatcagccagggaggacctg
agccaactggaagcacaggggcaggagacagagcagcagttccaggccctaagaaagcag
ctggagcaggtgacagaagacagggtctcggtgaaggcccaggtgacctcactgctgggt
gagctgcaagagagccagagccggctggagacctgcatgcatgagaagcaggcactggaa
gagcgggcacggacagctgtggaacagtgccgacggctggagggggacgtggaagctctg
caggagcagcatggggtgcagctggaccagctgcggctacaggcccagaatctggagaca
gcattgcgtgtggagcggcagggcgccacggaggagaaacggaagctggcacagctgcag
gtggcctatcaccagctcttccaggaatatgacagccacatcaagaacagcatagagggc
gagaagagggcccaggccttagagtggcagttggatgagctgtcgcagcagctgcagcag
gcagaagaggcactggtggccaagcaggagctgatcgacaagctcaaggaggaggctgag
catcaccgagctgtgctggagaccatccccgtgctcaaagcccaggctgacatctacaag
gctgacttcctggcggagcggcaggcacgggagcagctgcatggtcagcgtgaggacctg
caggagcagctagtaactttgcagcgtgactatgaggtgctaaaagctgatgctgccggc
accacacgggccctgatggaggagatgcggaaccgacactcagaggtgcgcccacctctg
cctgtgcccccaacagcttaccccctggctgtggggccataccaggctgcaccgcaccag
gggagcatctctgaggagcagccagatttctgctgccccaagtgccagtatcaggcaccc
gacatggacacacttcagatccacgtgatggactgcatcaagtga

DBGET integrated database retrieval system