KEGG   Alligator sinensis (Chinese alligator): 102374810Help
Entry
102374810         CDS       T02922                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00010  Glycolysis / Gluconeogenesis
asn00051  Fructose and mannose metabolism
asn00052  Galactose metabolism
asn00500  Starch and sucrose metabolism
asn00520  Amino sugar and nucleotide sugar metabolism
asn00524  Neomycin, kanamycin and gentamicin biosynthesis
asn01100  Metabolic pathways
asn01200  Carbon metabolism
asn04910  Insulin signaling pathway
Module
asn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
asn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102374810 (HK1)
   00051 Fructose and mannose metabolism
    102374810 (HK1)
   00052 Galactose metabolism
    102374810 (HK1)
   00500 Starch and sucrose metabolism
    102374810 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102374810 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102374810 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102374810 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:asn04131]
    102374810 (HK1)
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102374810 (HK1)
Membrane trafficking [BR:asn04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102374810 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 102374810
NCBI-ProteinID: XP_006023198
UniProt: A0A1U7RGT9
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MSTKENSHDFDENDSFCPPECKIDKYLYAMRLSDETLLDIMARFRREMKNGLSRDFNPTA
TIKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMETEIYNTPEDIM
HGTGTRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCRQSKLDEGILVTWTKRYKASG
VEGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYM
EEMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSG
MYMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRL
GVEPSHEDCIAVHHVCTIVSFRSANLVACTLGAILNQLRDNKGVPRLRTTVGVDGSLYKM
HPQYARRLHKTTRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRLIAETLAEFKL
THEQLLQVKKRMRMEMEAGMKKKTHDSAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFR
VLLVKIRSGKRRTVEMHNKIYAIPVEVMLGTGEELFDHIVACISDFLDYMGIKGARLPLG
FTFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTV
GTMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVEGDQGRMCVNMEWGAFGDNGCLD
DIRTIYDKAVDDYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTR
SIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSIIVKTVCGAVSRRAAQLCGAGMA
AVVDKIRENRGLEHLEITVGVDGTLYKLHPHFSKVMHQTVKDLAPKCDVTFLLSEDGSGK
GAALITAVGCRLRDAEQN
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaaggaaaactctcatgattttgatgaaaatgactctttctgtcctccagaa
tgcaaaattgataaatatctttatgctatgcggctctctgatgaaaccctgctggatatt
atggctcgcttcaggagagagatgaaaaacggtctttctagagacttcaatccaacagct
acaataaaaatgcttcctacatttgtaagatcgattcctgatggctcagagaaaggagat
ttcattgcattggatcttggtggatcttattttcgaattctgcgggtgaaggtctctcat
gaaaaaaagcagacggtacaaatggaaactgaaatttataacacaccagaggatatcatg
catggcactggaacaaggctgtttgatcatgttgccgaatgcctgggagacttcatggag
aaacagaaaatcaaggacaaaaaactaccagttggttttacattttctttcccatgtaga
caatccaagctggatgagggtattctggtaacatggacaaaacgctacaaagccagtgga
gttgaaggagcagatgttgtaaagctacttaacaaggcaatcaagaaacgtggggactat
gatgcagacatcatggctgttgtaaatgatacagtagggacaatgatgacctgtgggttt
gatgaccagcgttgtgaagtaggcttgattataggtactggcaccaatgcttgctacatg
gaagaaatgagacacattgatttggtggaaggtgatgaggggagaatgtgcatcaacacc
gagtggggagcctttggagatgatgggtcactagaagatatccgaactgagtttgatagg
gagattgaccgtggttctcttaatcctggaaaacaactatttgagaagatggtgagtgga
atgtacatgggtgaattggtcagactcatccttgtcaagatggccaaagaaggactgctt
tttgaagggagaatcactccagagcttttaaccaaaggaaaatttgaaacaaagcatgtt
tctgccatagaaaaaagcaaagaaggtttgaataaagccaaagaaattttgacacgcctt
ggtgtagagccatcccatgaagattgcattgctgtccatcatgtttgtacaatcgtttca
tttcgttctgcaaatctggttgcttgtaccttgggtgcaattctgaatcaactacgtgac
aataaaggagtacccaggctgcgtaccacagtgggggtagatggttccctttacaagatg
catccacaatatgcccgacgcttgcacaaaacaacaaggcgcttagttcctgactctgat
gtgcgattcctcctgtctgagagtggcagtggaaagggtgctgcaatggtcacagcagtg
gcttacaggttggctgagcagcacaggctgatagctgaaactctggctgaattcaagctt
actcacgaacagctattgcaggttaagaagaggatgcgaatggaaatggaagctggaatg
aagaagaaaactcatgatagtgcaaaagtgaaaatgctgcccacatttgtccgcagcaca
ccagatggaacagagaatggagacttcctggctcttgatcttggaggaacaaactttaga
gttttgcttgtgaagatacgtagtggtaaaaggagaacagttgaaatgcacaataaaata
tatgccatccctgtagaagtcatgctgggtactggtgaagagctgtttgatcacatagtt
gcctgcatctcggacttcctggattatatgggaataaaaggtgcacgccttccccttgga
tttacattttccttcccttgcaaacagacaagtttagatgctggtatcctcctcaactgg
accaagggttttaaagctacagactgtgaaggagaagatgttgtatatttgctcagggaa
ggaattaaacggagagaggaatttgacttggatgttgttgcagtggtcaatgatacagtt
ggcactatgatgacttgtgcgtatgaagatccaaactgtgagattggacttattgtggga
actggcagcaatgcatgttacatggaggaaatgaggaatatagagatggtggagggagat
caaggaagaatgtgtgtgaacatggaatggggtgcgtttggagacaatggatgcctggat
gacatcaggacaatttatgacaaagctgttgatgattattcattaaatgctggaaaacaa
aggtatgagaaaatgatcagtggaatgtaccttggagagattgttcgcaatattttgatt
gatttcactaaaagaggattcttgtttagaggtcaaatttcagagacactgaagaccaga
agtatctttgaaacgaagttcctttcacagattgagagtgacaggttagctttgcttcag
gtacgagcaatccttcagcagcttggcctgaacagtacctgtgatgacagtataattgta
aagacagtgtgtggggcagtatcacgaagagcagctcagttgtgtggagcgggaatggct
gctgttgtagataaaataagggagaacagaggattagaacacctggaaataactgtcggt
gtagatgggactctgtataaactacatccgcacttttcaaaggtaatgcaccaaacagta
aaggatctggctccaaagtgcgatgtgacgttcctgctttcggaagacggcagtgggaaa
ggggcagctctcattactgctgtgggatgccgacttcgtgacgctgaacaaaactaa

DBGET integrated database retrieval system