KEGG   Alligator sinensis (Chinese alligator): 102374890
Entry
102374890         CDS       T02922                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04060  Cytokine-cytokine receptor interaction
asn04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102374890 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102374890 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:asn04052]
    102374890 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:asn00536]
    102374890 (IL4)
Cytokines and growth factors [BR:asn04052]
 Cytokines
  Interleukins
   102374890 (IL4)
Glycosaminoglycan binding proteins [BR:asn00536]
 Heparan sulfate / Haparin
  Cytokines
   102374890 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 102374890
NCBI-ProteinID: XP_006023629
UniProt: A0A1U7RHQ0
LinkDB
Position
Unknown
AA seq 139 aa
MGVRFPVIVTCFCLLACNPLEARHQSRICWYKVLQEIIRSLNFLKEQKVSCKQMNVSDIF
EDPKENNQSEMLCKAAAVLTKAQCFCQECRHLKVIRVNLLELTRTVRCPVNTTSNTTLHG
FLERLTDLSQMIMKQNLVH
NT seq 420 nt   +upstreamnt  +downstreamnt
atgggtgttcggttccctgttatagtaacttgcttctgtttgctagcttgcaaccctctt
gaagccagacatcagtcccgtatctgctggtacaaagttttacaagagatcatcaggagc
ctgaatttcctcaaagagcagaaggtttcctgtaagcagatgaacgtgtcagatattttt
gaagacccaaaggagaacaaccagtcggaaatgttatgtaaagctgcagctgttcttaca
aaagcccagtgcttctgtcaggagtgccgtcatttgaaagttattcgcgttaacttattg
gaacttactcgtacggtccgatgtccagtgaacacaacgagcaatactacattacacgga
tttctagagaggctaacggatttatcccagatgataatgaagcaaaatcttgttcattag

DBGET integrated database retrieval system