KEGG   Alligator sinensis (Chinese alligator): 102375112Help
Entry
102375112         CDS       T02922                                 

Gene name
TGM1
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102375112 (TGM1)
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102375112 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 102375112
NCBI-ProteinID: XP_006039042
UniProt: A0A1U7SJJ4
LinkDB All DBs
Position
Unknown
AA seq 765 aa AA seqDB search
MLALSGVGAGASLQPRGRMPEPDTRYDVGRWASASLRTPPTMATQPPARPERRRRGVFSK
VCACCRCCAGRNDDADWGPAPGEVPGERRAEPVVREGMLVLNTVDLQSIRTGATRRAHHT
NEYESDALIVRRGQPFTVRLGFRQPYDPEEHRVCLEFLLGPTPQVAKGTHMLVPVGAAGT
QGWQAEEVDSTGTTLTVRVTSAPTAPIGCYRLGVKTRSPAGEYAAPFDPRHQVYLLFNPW
CSRDSVYLDNDNLLEEYVLNESGRIFYGTDAQIGERTWNYGQFDQGVLDACLYMLDRRGM
PHAGRGDPINVSRVVSAMVNSLDDNGVLIGNWTGDYSRGTNPSAWVGSVDILRQYHRSQQ
PVPYGQCWVFAGVTTSVLRCLGIATRTVTNYNSAHDTDVSLTMDIYFDENMKPLEKLNAD
SVWNFHVWNDCWMKRPDLPPGFDGWQVVDATPQETSSGIFCCGPCPVEAIKNGLVYLKYD
APFIFAEVNSDKVYWQRQADGNFKIVYVEENAIGRLISTKAAGSHQRHDITHLYKHPEGS
EAERKAVETAARYGTKAHVYAGRSGGEDVVVSVEATEAVTGQDMHLSVALTNRSTGPRSV
SLNLHVAITYYTGVAGPVVKQERRQVELPPNGAQTVPLVVSYAEYQPHMVDQCAMKLSVS
GKVAETGQVLAKQHNFRLRTPDLTLTLVGPAIVGQETHVQIVFKNPLPQTLKGAVLHMEG
AGLCSPKTITVGDIAGYQTVRLRQNFVPLRPGRRQLAASPGSPPL
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctctaagcggggttggagcgggagcttccctccagccccgaggcaggatgccg
gagccagacacccgctatgatgtggggcgctgggccagcgccagcctgcgcacccctccc
accatggccacccagcctcctgcccggcctgagcgccggcgccgcggtgtcttcagcaag
gtgtgcgcctgctgccgctgctgtgctggccgcaatgatgatgctgactggggccctgca
cccggcgaggtccctggggagcgccgtgccgaacccgtggtgagagagggcatgctggtg
ctgaacacggtggatctgcagagcatccgcacgggggccacgcgtcgcgcccaccacaca
aacgagtacgagtcggatgcactgattgtgcggcgggggcagcctttcaccgtgcgcctc
ggcttccgccagccctacgaccctgaggagcaccgtgtctgcctagagttccttctcggc
ccgacgccacaggtggctaagggcacccacatgctggtgccggtgggcgctgcagggacg
cagggctggcaggccgaggaggtggacagcacgggcaccactctcacagtgcgggtcacc
tcggcacccactgcccccattgggtgctacaggctgggcgtgaagacgcggagccctgca
ggggagtacgctgcgcccttcgacccccgccaccaggtctacctgctcttcaacccctgg
tgctccagggactcggtgtacctagacaatgacaacttgctggaggagtacgtgctcaac
gagagtgggcgcatcttctacggcactgacgcccagatcggcgagcgcacctggaactat
gggcagtttgaccagggggtgctggacgcctgcctgtacatgctggaccggcgtgggatg
cctcatgcgggtcgcggggaccccatcaatgtctcccgcgtcgtgtccgccatggtgaac
tcactggatgacaatggggtgctgattggcaactggacgggcgactactcgcgtggcacc
aacccatcggcctgggtgggcagtgtggacatcctgcggcagtaccaccgctctcaacag
cctgtgccctatggccagtgctgggtcttcgccggcgtcaccaccagtgtactgcggtgc
ctgggcatcgccacgcgcacagtgaccaactacaactccgcgcacgacacggacgtcagc
ctcaccatggacatctactttgacgagaacatgaagccccttgagaagctcaacgctgat
tcagtctggaacttccacgtgtggaacgactgctggatgaagcgccctgacctcccacct
ggctttgacgggtggcaggtggtggatgccaccccccaggagaccagcagtgggattttc
tgctgtgggccctgccccgtggaagccatcaagaatgggctggtctacctgaagtacgat
gcccccttcatctttgccgaggtgaacagcgacaaggtatactggcagcgccaggccgat
ggcaacttcaaaatcgtgtacgtggaggagaatgccatcgggcgcctcatcagcaccaag
gccgcgggctcgcaccagcgccacgacatcacccacctctacaagcaccctgagggctca
gaggcggagcgcaaggcggtggagacagcagcccgctatggcaccaaggcacacgtgtat
gcagggcgcagtggcggcgaggacgtggtggtgagcgtggaggccaccgaagcagtgacg
ggacaggacatgcacctgagtgtggcactgaccaaccgcagcaccgggccccgctccgtc
agcctcaacctgcacgtggccatcacctactacactggtgttgctgggcccgtcgtcaag
caggagcgccgccaggtcgagctcccgcccaacggagcccagacagtgcccctggtggtg
tcgtacgcggagtaccagccgcacatggtggaccagtgcgccatgaagctgagcgtgtca
gggaaggtggctgagaccgggcaggtgctggccaagcagcacaacttccgcctgcgcacg
cctgacctcaccctcacgctggtgggcccagccatagtggggcaggagacccatgtccag
atcgtcttcaagaacccgctgcctcagacgctgaagggggctgtcctccacatggagggt
gccgggctgtgcagccccaagaccatcaccgtgggggacatcgccgggtaccagacggtg
cggctgcgccaaaacttcgtgcccctgcggcctgggcgccgccagctggcggccagcccg
ggcagccccccgctc

DBGET integrated database retrieval system