KEGG   Alligator sinensis (Chinese alligator): 102375492
Entry
102375492         CDS       T02922                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04010  MAPK signaling pathway
asn04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102375492 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102375492 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:asn04052]
    102375492 (KITLG)
Cytokines and growth factors [BR:asn04052]
 Growth factors
  Growth factors (RTK binding)
   102375492 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 102375492
NCBI-ProteinID: XP_006036108
UniProt: A0A1U7S7C5
LinkDB
Position
Unknown
AA seq 278 aa
MKRTQTWIITCFYLQLLLLNPLVRAHSPCGNPVTDDVNDITILVGNLPNDYRITLKYVEK
MESLPNHCWLYLMVPEFSKSLSNLLHKFSQISDVLSNRSIINNLTRIINDLMECLALDKN
KNFKQESDHLYKEGKFIPEEFFRHFNNTIEAYKTFSETSDYDDCVLPSTTETPVHDSKVT
ETKPFSLPPVAASSLKNNNDSSVQDTLGYTSSSSLQGISIALPSLFSLLIGLALGAVCWK
KTHPKSQPESEETERGSDCREENEISMLQQKEKELLQV
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaagaggacacaaacttggattatcacttgcttttatcttcagctgctcctacttaat
ccacttgtcagagctcatagtccctgtgggaatccagtgacagatgatgtgaatgacatt
acaatattggttggaaatcttccaaatgattataggataacccttaaatatgtcgagaag
atggaaagtctgcctaatcactgttggttgtatttgatggtgcctgaattttcaaagagt
ctgagtaatctgctccacaaattttcacaaatatctgatgttttaagcaaccgttcaatc
atcaataatctcacaaggataattaatgatcttatggaatgtctagcattagataaaaat
aagaattttaaacaagaaagcgatcacctgtataaagaaggcaagttcattcctgaggaa
ttctttaggcattttaacaacaccattgaagcctataagacgttttcagaaacatcagat
tatgatgactgtgttctgccttcaacaacagaaacaccagttcatgattccaaggtcact
gaaacaaagccattttcattacctcctgttgctgccagttcccttaagaataacaatgat
agcagtgtccaggatacacttggctacactagcagctctagcctgcaagggataagcata
gcattgccatcattgttttctcttcttattggccttgctttgggagcagtatgctggaag
aaaacacatcccaaatctcaaccagaaagtgaagaaactgaacggggtagtgactgtcga
gaagaaaatgagataagtatgttgcagcaaaaagaaaaagagcttttacaagtgtag

DBGET integrated database retrieval system