KEGG   Alligator sinensis (Chinese alligator): 102375867Help
Entry
102375867         CDS       T02922                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8 isoform X1
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:asn03036]
    102375867 (HDAC8)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102375867 (HDAC8)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102375867 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102375867
NCBI-ProteinID: XP_025061723
LinkDB All DBs
Position
Unknown
AA seq 333 aa AA seqDB search
MEEMASFHTDAYLQHLQKVSEEGDDDHPESVEYGLGYDCPATEGIFDYAAAVGGATITAA
QCLMDGKCKVAINWPGGWHHAKKDEASGFCYLNDVVLGILKLRQKFDRILYIDLDLHHGD
GVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSEVGLGKGRYYTVNVPIQDGIQDEKYYQI
CETVLKEVYAAFNPEAVVLQLGADTIAGDPMCSFNMTPVGVGKCLKYVLQWQLATLILGG
GGYNLANTARCWTYLTGVILGRTLSSEIPDHEFFTEYGPDYVLEITPSCRPDRNEPQRIQ
EVLNSIKDSLHWAHGIYWKRKLLALTGNLKHVV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggaggagatggcgagctttcacactgatgcctatctgcagcacctacaaaaagttagt
gaggaaggggatgatgatcacccagaatctgtggagtatggacttggttatgactgtcca
gccactgaaggaatctttgactatgcagcagctgttggaggagccaccattacagcagcc
caatgtctgatggatggcaagtgcaaggtagcgattaactggcctggagggtggcatcat
gcaaagaaagatgaagcttcaggcttttgttacctgaatgatgttgtcctgggtatcctg
aaactccgacagaagtttgaccgcatcctctacattgacttagatttgcatcacggggac
ggtgttgaagatgcctttagtttcacttccaaagtcatgactgtctctcttcataaattt
tctccaggatttttcccaggtactggtgatgtgtctgaggttggcctggggaaggggcgc
tattacactgtcaatgtgcccattcaagatggcattcaggatgagaagtattaccagatc
tgtgaaacagtgctgaaggaagtgtatgcagcgttcaaccccgaagccgtagtcctgcag
ctgggagcggatacaatagctggggacccgatgtgttcatttaacatgactccagtgggg
gttggcaaatgtctgaaatacgttctgcagtggcagctggctaccctcatcctgggagga
ggaggctacaatcttgccaacacagcccgctgctggacatacttgactggggtcatcctg
gggagaacgctgtcctctgagatcccagatcacgagtttttcacagagtatggtcctgat
tatgttctggagattaccccaagctgcaggccagaccgcaatgagccacagagaatccag
gaagttctcaactccatcaaagatagtcttcattgggcccatggcatctactggaagaga
aagctactggctcttacagggaatctgaagcacgtggtgtag

DBGET integrated database retrieval system