KEGG   Alligator sinensis (Chinese alligator): 102376796Help
Entry
102376796         CDS       T02922                                 

Gene name
LIG3
Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn03410  Base excision repair
Module
asn_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:asn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    102376796 (LIG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:asn03400]
    102376796 (LIG3)
Enzymes [BR:asn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102376796 (LIG3)
DNA repair and recombination proteins [BR:asn03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     102376796 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase
Motif
Other DBs
NCBI-GeneID: 102376796
NCBI-ProteinID: XP_006025809
UniProt: A0A1U7RM07
LinkDB All DBs
Position
Unknown
AA seq 906 aa AA seqDB search
MAEQRYCVDYAKRGTAGCKKCKEKILKGMVRIGKVVPNPFTESGGDMKEWYHVKCIFEKL
ERARATTKKIEDITDLEGWEELQDAEKDLINQLISEATSKSASTPKKKATVQAKLSPSGQ
ITSPKKDPGAVPNPSPKKFSGFTAKPGSSEDTPANSSHKSTLSSKKCDPKHKDCLLREFR
KLCAMVADKPSYNVKTQIIQDFLQKGTGGDGFHGDLYLTIKLLLPGVIKIVYNLNDKQIV
KLFSRIFNCSQDEMVRDLEQGDVSETVRIFFEESRSCPPAAKSLLTIQEVDEFLIGLSKL
TKEDDQQTLLQGITRRCTGNDLKCIIRLIKHDLKMNAGAKHVLDALDPNAYEAFKASRNL
QDVVERVLRNQQEAEKQPGLKRTLSVQASLMTPVQPMLAEACKSIEYAMKKCPNGMYAEI
KYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAHFKDFIPRAFPGGHSMILDSEVLLIDNK
TGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIPXP
DPLLRDEACHKSFRSGRYDNRVIREGLEGLVLKDIKSTYEPGKRHWLKVKKDYLNEGAMA
DTADLVVLGAFYGQGSKGGMMSIFLMGCYDPKTEKWCTVTKCSGGHDDATLARLQNELDM
VKISKDPNKIPSWLKINKLYYPDFIVPDPKKAPVWEITGAEFSKAEAHTADGISIRFPRC
TRIRDDKDWKTATNLPQLKELYQLSKEKSDFSVVAGEEEVSPAGSSGENDGNSGSSTPHN
TPKTPPRKSPAKTKKSEGNNLVYVTPEKKVEDKRGEKRKAAELDDNGKKILLDIFTGVRL
YLPPSVENFSKIRRYFVAYDGDLVQEFDTASATHVIGDLEENPGAKRVSPSWIWECIRKR
RLVAPC
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacagcggtactgcgtggactacgccaagcgcggcacggccggctgcaagaag
tgcaaggagaagatcctgaagggcatggtccgcattgggaaggttgtgcccaaccccttc
accgagtcgggcggcgacatgaaggagtggtaccacgtgaagtgcatattcgagaagctg
gagcgggctcgtgccaccaccaagaagatcgaggacatcacagacctcgaggggtgggag
gagctgcaagacgccgagaaagacctcatcaaccagcttatctcggaggccacatccaag
tctgcaagcacacctaagaagaaggcaacagtccaggctaagctgtcccccagtgggcag
ataacctcccccaagaaagatccaggagctgttcctaatccatctccaaagaaattctct
ggtttcacagctaaaccaggcagttctgaggacacccctgcaaattcttcccacaagtct
actctgtcttcaaagaagtgtgacccaaagcacaaggattgtttgttgcgggaattcaga
aaattgtgcgccatggttgctgacaaacccagctataacgtgaaaacacagatcatccag
gactttctgcagaaagggactgggggagatggctttcatggtgacttgtacctgactatt
aagctgctgttgccgggtgtcattaaaattgtgtacaacttgaatgacaagcagattgta
aagctgttcagcagaattttcaactgcagccaggatgaaatggtccgggacctggagcag
ggagatgtttcagaaacagtccgcatcttttttgaggagagcaggtcctgtcctccagct
gccaaaagtctcctcacaatccaggaagtggacgagttcctaatcggactgtcaaagctt
acaaaggaggatgaccagcaaactctgcttcagggtatcactcgcaggtgcacgggcaat
gacctgaaatgcatcatcaggcttataaagcacgatttgaaaatgaatgctggtgcaaag
catgtgttagatgctttggatccaaatgcctatgaggcattcaaagcatcacgcaatctt
caggatgttgtggagcgtgtgctaagaaaccagcaggaggcagagaagcagccgggtctg
aagcgaaccctcagtgtgcaggcctctctgatgacccctgttcagcctatgctggctgaa
gcctgcaagtcaatagaatatgccatgaagaagtgtccgaatgggatgtacgcagagatc
aagtatgatggggagcgagtgcaggtccacaagaatggagatcatttcagctacttcagc
cgaagcctcaagccagtccttcctcacaaagtggcccattttaaggacttcatccccaga
gcttttcctggtggacacagtatgatcttggattcagaagttcttctcattgacaacaaa
acaggcaaaccactcccttttgggacccttggagtccacaagaaagctgctttccaagat
gccaatgtctgcttgtttgtatttgattgtatctacttcaatgatgtcagcctgatggac
aggcctttgtgtgagcgtcgtaagtttctccatgataacatggttgaaatccccnagccg
gatcctcttctccgagatgaagcatgtcacaaaagcttcagatctggcagatatgataat
agagtcatccgtgagggactggaaggactggtgctgaaggatataaagagcacgtatgag
ccaggaaaacgtcactggctgaaagtgaaaaaggactatctaaatgaaggtgccatggct
gatacagcagacctggtggttctgggagctttctacggacaaggcagtaaaggtggaatg
atgtcaattttcctaatgggctgctatgatcccaagactgaaaaatggtgtacggtgaca
aagtgctctggtgggcatgatgatgccaccttagctcgcctgcagaatgagctggacatg
gtgaagatcagcaaggatcccaataaaattccaagctggctaaaaataaataagctctac
tatccagatttcattgttccagacccaaagaaggccccagtgtgggagataacaggtgcg
gagttctctaaagcagaagcccacacggcagatgggatttccattcgtttccctcgttgt
acccggatccgagatgacaaagactggaagacagctaccaatctccctcaactcaaggag
ctgtaccagctctccaaagagaagtctgatttcagtgttgttgctggagaggaggaggta
tctccagctggtagcagtggagagaatgatggaaattcagggtcttccacaccacacaat
actcctaaaactcccccaaggaagtcgcctgcaaaaaccaagaagtctgaaggtaacaat
ttagtctatgtgacccccgaaaagaaagtggaggataaacgaggggagaagcggaaagca
gccgagctggatgacaatgggaagaagatattgctggacatatttacaggggtgaggctg
tacctaccaccctccgtggagaacttcagcaaaatccggcggtactttgtggcatatgat
ggggaccttgtacaagagtttgatacggcttctgcaacacatgtgataggggaccttgag
gagaaccctggagctaagcgtgtgtcacccagttggatctgggagtgtatccgcaagcgg
agactggtagccccctgctaa

DBGET integrated database retrieval system