KEGG   Alligator sinensis (Chinese alligator): 102376844Help
Entry
102376844         CDS       T02922                                 

Gene name
GAMT
Definition
(RefSeq) guanidinoacetate N-methyltransferase
  KO
K00542  guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00260  Glycine, serine and threonine metabolism
asn00330  Arginine and proline metabolism
asn01100  Metabolic pathways
Module
asn_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102376844 (GAMT)
   00330 Arginine and proline metabolism
    102376844 (GAMT)
Enzymes [BR:asn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     102376844 (GAMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_23 Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 102376844
NCBI-ProteinID: XP_006017495
UniProt: A0A1U7RNH5
LinkDB All DBs
Position
Unknown
AA seq 237 aa AA seqDB search
MSSSEAASPIFHQGENCKPSWTEAEAGYNQTDTHLKILGKPVMERWETPYMHSLATVAAS
KGGRVLEVGFGMAIAASKVEEFNIEEHWIVECNEGVFKRLEEWAKKQPHKVVPLRGLWED
VVPTLPDGLFDGILYDTYPLSAETWHTHQFHFIKSHAFRLLKPGGVLTYCNLTSWGELLK
TKYTDIEKMFEETQVGHLVEAGFKRENISTAVMDLTPPQDCRYYAFPKMITPTVVKQ
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagctcctcggaggctgccagtcccatcttccaccagggagagaactgcaagccatca
tggacggaggccgaggctggctacaatcagacggacacccacttgaagatcctgggcaag
ccagtgatggagcggtgggagaccccctacatgcattcgctggctactgttgcagcatcc
aaagggggccgcgtgctggaagtgggcttcggcatggccattgccgccagcaaagtggaa
gagttcaacatcgaggagcactggatcgtcgaatgcaatgagggcgtcttcaagaggctg
gaggagtgggccaagaaacagccccacaaggtcgtccccttgaggggcctgtgggaagat
gtggtccccacgctgccggatggactttttgatggcatcctgtacgacacctaccccctg
tccgcagagacctggcacactcatcaattccacttcatcaagagccatgctttccgcttg
ctgaagcccggtggcgtcctcacctactgcaacctgacatcatggggggagctgctcaag
accaagtacacagacatcgagaagatgtttgaggagactcaggtcgggcacctggtcgag
gctgggttcaagagggagaacatcagcacagcagtgatggacctgaccccgccccaggac
tgcaggtactacgccttccccaagatgatcacgcccaccgtcgtcaagcagtga

DBGET integrated database retrieval system