KEGG   Alligator sinensis (Chinese alligator): 102377458
Entry
102377458         CDS       T02922                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04010  MAPK signaling pathway
asn04137  Mitophagy - animal
asn04210  Apoptosis
asn04218  Cellular senescence
asn04620  Toll-like receptor signaling pathway
asn04621  NOD-like receptor signaling pathway
asn04622  RIG-I-like receptor signaling pathway
asn04623  Cytosolic DNA-sensing pathway
asn04625  C-type lectin receptor signaling pathway
asn04920  Adipocytokine signaling pathway
asn05132  Salmonella infection
asn05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102377458 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102377458 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    102377458 (RELA)
   04218 Cellular senescence
    102377458 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102377458 (RELA)
   04621 NOD-like receptor signaling pathway
    102377458 (RELA)
   04622 RIG-I-like receptor signaling pathway
    102377458 (RELA)
   04623 Cytosolic DNA-sensing pathway
    102377458 (RELA)
   04625 C-type lectin receptor signaling pathway
    102377458 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102377458 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102377458 (RELA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102377458 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:asn03000]
    102377458 (RELA)
Transcription factors [BR:asn03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102377458 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 102377458
NCBI-ProteinID: XP_025049355
UniProt: A0A3Q0FT76
LinkDB
Position
Unknown
AA seq 554 aa
GTPPVTPRSLTSSCLCLLPDLLPLLLQPDWHMEPVPSSTPFVEIIEQPKQRGMRFRYKCE
GLPRPLGSLLPMAAPPLQINNYTGPGKIRISLVTKDAPYRPHPHELVGKDCKDGYYEAEL
ASERNIHSFQNLGIQCVKKRELEEAVAQRIRTNNNPFNVSLEEKGEYDLNAVRLCFQVWV
QDPAGTGHLMLLPLIVSQPIYDNRAPNTAELKICRVNRNSGSCRGGEEIFLLCDKVQKED
IEVRFFRDTWEARGSFSQADVHRQVAIVFKTPPYADQALREPVTVHMQLRRPSDREVSEA
MEFRYLPEEGDFHCIEEKRKRTRDTFKSFVQKTPFAGGWGLGKGEGLLPGAGCRKGRSPG
GGGTWRRGGAEPPLKPPSAFPFATAVPRGPPLLQTLPPASMAAMGPPPVNTFSTVNLEEF
SSLGLSPRPPGEAETHLADALLQLQFEGNADGPGGLDLDALVDDVTYTSLEAINTAEFRQ
LLQGQPGGGATEPGPPMLLSYPESITRLVNSQRGAPDGEDPGASSFVNGALGDEMLPSMG
DLDLSALLSQLGSS
NT seq 1665 nt   +upstreamnt  +downstreamnt
gggacccccccagtcacccccaggtcactaacctcctcttgcctgtgtctccttccagat
ctgctgcctcttctcctccagccggactggcacatggagccagtgccgagctcgacgccc
ttcgtagaaatcatcgagcagcccaagcagcgcgggatgcgcttccgctacaagtgcgag
gggctgcccagacccctgggttccctcctgccaatggctgcccctcccctgcagatcaat
aactacacgggccccgggaagatccgcatctcactggtgaccaaggacgccccgtaccgg
ccgcacccccacgagctggtgggcaaggactgcaaggacggctactatgaggctgagctg
gcctctgagcgcaacatccacagcttccagaacctgggcatccagtgtgtgaagaaacgg
gaactggaagaggctgtggcccagcgcatccgcaccaacaacaaccccttcaatgtgtca
ctggaggagaagggcgagtacgacctgaacgccgtgcgcctctgcttccaggtgtgggtg
caggatccagccggcactgggcacctcatgctcttgcccctcattgtctcccagcctatc
tacgacaaccgggctcccaacacggcggagttgaagatctgccgggtgaatcgtaactcc
gggagctgccgggggggcgaggagatcttcctgctctgcgacaaggtgcagaaggaggac
atcgaggtgcggttcttccgggacacgtgggaggcgcgcggctccttctcgcaggccgac
gtgcaccgccaggtcgccatcgtgttcaagacgccgccctacgccgaccaggcgctgcgc
gagcccgtcacagtgcacatgcagctgcggcgcccgtccgaccgcgaggtcagcgaggcg
atggagttccgctacctgcccgaggaaggtgacttccactgcatcgaggagaagcggaag
cgaacccgcgacaccttcaagagttttgtgcagaagaccccctttgcaggtgggtggggc
ttggggaaaggggaggggcttctccctggagcagggtgtagaaagggaaggagtccgggt
gggggaggtacctggcggaggggtggggctgagcccccactgaagccccccagtgccttc
cccttcgccactgcagtaccccggggcccgccactgctgcagaccctgccccccgcctcc
atggctgccatgggcccgccccctgtcaacaccttcagcacagtgaacctggaggagttc
tccagcctggggctgtcgccgcggccccccggcgaggcggagacccacctggccgacgcg
ctgctgcagctgcagttcgagggcaacgcggacgggccgggggggctggacctggacgcg
ctggtggacgacgtgacctacaccagcctggaggccatcaacacggccgagtttcggcag
ctgctgcaggggcaaccgggggggggcgccacggagcccggcccccccatgctgctctcc
taccccgagtccatcacgcgcctggtgaacagccagcggggggcaccggacggcgaggac
ccaggcgccagcagctttgtcaacggggcgctgggcgacgagatgctgccctccatgggc
gacctggacctgtcagcgctgctcagccagctcgggtcgtcctag

DBGET integrated database retrieval system