KEGG   Alligator sinensis (Chinese alligator): 102378120
Entry
102378120         CDS       T02922                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04010  MAPK signaling pathway
asn04020  Calcium signaling pathway
asn04144  Endocytosis
asn04510  Focal adhesion
asn04540  Gap junction
asn04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102378120 (PDGFRA)
   04020 Calcium signaling pathway
    102378120 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102378120 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102378120 (PDGFRA)
   04540 Gap junction
    102378120 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102378120 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:asn01001]
    102378120 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:asn04090]
    102378120 (PDGFRA)
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102378120 (PDGFRA)
Protein kinases [BR:asn01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102378120 (PDGFRA)
CD molecules [BR:asn04090]
 Proteins
  102378120 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 102378120
NCBI-ProteinID: XP_006019081
UniProt: A0A1U7RJ94
LinkDB
Position
Unknown
AA seq 1087 aa
MGTFPRTLLGLGCILTGPWLTFCQLPLPTIFPNKNEMVVQLNSSFTLKCSGDSEVSWQYP
MAEENQKIDIRLEENNSGLFVTVLEVGDASAALTGLYTCYYNHTQVEDGEVEGTDIYIYV
PDPDIPFVPTLQEDQFILIEEGDSTVIPCRTTDPDAQVTLINSEAKPLYAFYDSKQGFIG
NFPAGTYTCKTTVKGVEFKSDEFFIYILRATSQLPVKIEALKTVYKKGETIVVTCVVSHN
EVVNLDWNYPGKVKEKGVIKLDDIKVPHQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENRRVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVHAYPTPKMFWLKDNVTLIENL
TEIVTSSNKIHETRFQSTLKLIRAKEEDSGYYTLVAENEDETKRYTFSLLIQVPALILDL
VDNHHGSAGGQTVRCLAEGTPLPDVEWLICKDIKKCSNDTSWILLTSNISDISMEAHLDE
KNMVESQVTFQKVEETLAVRCIARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKLKKDLDIFGMNPADESTRSY
VILSFENNGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSMYDRPASYKKKSMSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVECLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNTYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDIMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtactttcccaaggacactcctgggcctgggatgtatcctaacaggaccatggcta
acattttgccagcttccattgccaactatatttccaaataaaaatgaaatggttgtgcag
ttgaattcctctttcaccctgaaatgctctggggacagcgaagtgagctggcaataccct
atggctgaagaaaaccagaaaatagacattagacttgaagagaacaacagtggcctcttt
gtgactgtgcttgaagtaggagatgcctcagctgctcttactggattatacacttgctat
tacaatcatacccaagtggaggatggtgaagtagaggggacggatatttacatctatgta
cctgatccagatatcccttttgttcctacgctacaagaggatcaattcattctaatagaa
gaaggcgattccactgttatcccttgtcgtacaactgaccctgatgctcaagtaacctta
attaacagtgaagccaagcccttatatgccttttatgatagcaagcagggcttcatagga
aattttcctgcaggcacatacacatgcaaaacaactgttaaaggagtggagttcaagtcc
gatgagttctttatatatattttgagagctacttcacagctgccagttaagattgaagcc
cttaaaactgtatataaaaaaggcgaaaccattgttgtaacatgtgtggtctctcacaat
gaggttgttaatttagattggaattatccagggaaagtgaaagaaaaaggtgtgataaaa
cttgatgacataaaagttccacaccagaagctggtttacaccttgactattccggaggca
tcagtgaaagacactggggattatgaatgcactgccagacatgcaaccaaggaggttaag
gaaaataggagagtagtcattacagttcacgacaaaggattcattcatctggagccccag
tttagtcctttggaagctgtcaatctccatgaggtcaaaaattttgtagttgatgtgcac
gcatatccaactccaaaaatgttctggctgaaggacaatgtgaccctgattgagaatctt
accgagattgttactagttcaaataagatccatgagacaaggtttcaaagtacattaaaa
ctgattagagctaaggaagaagacagtggatattacaccttggttgctgaaaatgaagat
gagactaaaagatatactttctcattactaatacaagttccagccttaattctagacctg
gtggataatcatcatggctcagccggaggacagacagtaaggtgcttggcagaagggaca
cctcttcctgatgttgaatggctaatttgcaaggacattaaaaaatgcagcaatgatacc
tcatggatacttctgactagcaacatctcagatattagcatggaggctcatttggatgag
aagaacatggtggaaagccaggtgaccttccagaaggtagaagaaaccctggcagttcgg
tgcattgcaaggaacgaccttggtgctgttactcgggagctgaagcttgtggctcctaca
ttgcgatcagagttaactgtggctgctgcagtcctagtgttgttagtaattgtgattatc
tcactgattgtcctggtcatcatatggaaacagaagccacgatatgagataagatggaga
gtcattgaatcaatcagtcctgacggccatgaatacatctatgtggacccaatgcaactg
ccatatgactcaagatgggagtttcctagagatggattagtccttggtcgaattcttggt
tctggtgcatttggcaaagttgttgagggaactgcatatgggttaagtcgctctcaacca
gtgatgaaggtagctgtgaaaatgctgaaacccacagcgagatccagcgaaaaacaagca
ctaatgtctgaactgaagataatgacacatcttgggccacatttgaacattgtgaatctg
ttaggagcttgtaccaaatcaggtccaatttacatcattactgaatactgcttttatgga
gatttggtaaactacttgcataagaatagagataattttctaagccgacacccagaaaag
ctgaagaaggacttggacatctttggcatgaacccagctgatgaaagcacaagaagttat
gtaattttatcctttgaaaacaatggagaatacatggacatgaaacaagctgatacgacc
cagtatgtgcccatgctggaaaggaaggagggttctaaatattctgatatccagagatct
atgtatgatcgacctgcttcatacaagaagaaatccatgtcagaatctgaagtcaagaac
ctactttctgatgacagttctgaaggcctcagcctattggacttactgagcttcacctat
caagtagcacggggaatggagttcttggcttctaaaaattgtgtgcaccgtgacttggca
gctcgtaatgtccttctagctcaaggaaaaattgtgaagatctgtgactttggtctggct
agggacatcatgcatgattccaactatgtctccaaaggcagtacatttcttccagtgaaa
tggatggcacctgagagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggcattctactgtgggaaatattttctcttggtggcacaccttaccctggaatgatg
gttgattctactttctataacaagataaaaagtggctaccgaatggcaaaacctgaccat
gccaccaatgaggtgtatgagatcatggtgaagtgttggaacagtgaaccagaaaaaaga
ccttctttttaccatttgagtgaaattgttgagtgtctattgcccggagagtacaaaaag
agctatgaaaagattcatctggacttcctaaaaagtgaccacccagctgtcacacgcatg
agaggggactgtgacaacacctatattggtgtcacctacaagaatgaagacaaactcaag
gatagggagagcggatttgatgagcagaggctgagtgctgacagtggatacatcatccct
ctgcctgacattgaccctgtatctgaagatgagcttggcaaaagaaacaggcacagttcc
caaacatctgaagaaagtgctattgagactggttccagcagctctacctttatcaagaga
gaggatgagaccattgaggacattgacataatggatgacattggaatagattcctcagat
ctggttgaggacagcttcctgtaa

DBGET integrated database retrieval system