KEGG   Alligator sinensis (Chinese alligator): 102378805Help
Entry
102378805         CDS       T02922                                 

Gene name
SUV39H1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1 isoform X1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102378805 (SUV39H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:asn03036]
    102378805 (SUV39H1)
Enzymes [BR:asn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102378805 (SUV39H1)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102378805 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102378805 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo HTH_32
Motif
Other DBs
NCBI-GeneID: 102378805
NCBI-ProteinID: XP_006032062
UniProt: A0A1U7RZK5
LinkDB All DBs
Position
Unknown
AA seq 417 aa AA seqDB search
MAENLKGCSVYCKSSWVQLQDLCRLAKVVCPDLGVTRRNLSHFEVEYLCDYKRVREEEFY
LVKWRGYPESESTWEPRKNLRCPGVLKQFHQDLEAALQRWSRPGRPRRPPLHGLEPLVAA
YLLQKAKQRRALWRWECQLNAKRSHRGRITVENEVDLDGPPRDFIYINEYKVGAGITLTQ
VAVGCECQDCLAQPAGGCCPGASRHRFAYNEQGQVRVRAGLPIYECNARCRCGPDCPNRV
VQKGIRYDLCIFRTDNGRGWGVRTLEKIRKNTFVMEYVGEIITSEEAERRGQIYDRQGAT
YLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIALFATRPIR
AGEELTFDYNMHVDPVDAESTRMDSNLGLAGGLAGSPKKRLRIECKCGAPACRKYLF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgctctgtgtactgcaagtcatcatgggtacagctgcag
gacctgtgccgcctggccaaggtggtatgtcccgacctgggtgtcactcgtcgcaacctc
agccactttgaggtggagtacctgtgtgactacaagcgtgtgcgggaggaggagttctac
ctggtgaagtggcgaggttaccctgagtcggagagcacgtgggagccccgtaaaaacctg
cgctgccccggcgtcctcaagcagtttcatcaggacctggaggcagcactacagcgctgg
tcccgacctggccggccccggaggcctccactccatggcctggagccccttgtggctgcc
tacctgctgcagaaggccaagcagcggcgagccttgtggcgctgggagtgccagctcaat
gccaagcgcagccaccgtggccgcatcactgtggagaacgaggtggacctggatggtccc
ccccgggacttcatctacatcaacgagtacaaggtgggggctggcatcaccctcacccag
gtggccgtgggatgcgagtgccaggactgcttggcccagccggctggcggctgctgccct
ggtgcttcacgccaccgctttgcctacaacgaacaagggcaggtgcgggtgcgggctggg
ctgcccatctacgagtgcaatgcccggtgccgctgtggccctgactgccccaaccgtgtg
gtgcagaaaggcatccgctatgacttgtgcatcttccgtaccgacaacggccggggctgg
ggcgtgcgcacgcttgagaagatccgcaaaaacacttttgtcatggagtacgttggcgag
atcatcacatcggaggaggcagagcggcgggggcagatctatgaccgccagggggccacg
tacctctttgacctggactacgtagaggacgtctacactgtggatgctgcctactacggc
aacatatcccacttcgtcaaccacagctgtgaccccaacctgcaggtgtacaatgtgttc
attgacaacctagatgagcgcctgccacgcatcgcgctcttcgccacccggcccatccgt
gccggcgaggagctcacttttgactacaacatgcacgtagacccagtggatgcagaaagc
acgcgcatggactcgaacctggggctggccgggggcctggctgggtcccccaagaagcgc
ctgcgcatcgaatgcaagtgcggggcacctgcctgtcgcaagtacctcttctag

DBGET integrated database retrieval system