KEGG   Alligator sinensis (Chinese alligator): 102378816
Entry
102378816         CDS       T02922                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04068  FoxO signaling pathway
asn04110  Cell cycle
asn04115  p53 signaling pathway
asn04218  Cellular senescence
asn04310  Wnt signaling pathway
asn04340  Hedgehog signaling pathway
asn04371  Apelin signaling pathway
asn04510  Focal adhesion
asn04530  Tight junction
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102378816 (CCND1)
   04340 Hedgehog signaling pathway
    102378816 (CCND1)
   04371 Apelin signaling pathway
    102378816 (CCND1)
   04068 FoxO signaling pathway
    102378816 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102378816 (CCND1)
   04115 p53 signaling pathway
    102378816 (CCND1)
   04218 Cellular senescence
    102378816 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102378816 (CCND1)
   04530 Tight junction
    102378816 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102378816
NCBI-ProteinID: XP_006014750
UniProt: A0A1U7RAZ8
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLLAMLKAEETCTPSGFYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAVTPHDFIEHFLTKMPLTEDTKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNISSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggaaaccatccgaagagcctacctagacgcc
aacctactgaatgacagggtcctgctggccatgctgaaggcggaggagacctgcacgccc
tcgggcttctacttcaagtgcgtgcaaaaggagatcttgccctacatgcggaaaatagtg
gccacttggatgctggaggtttgtgaggagcagaaatgcgaagaggaggtgttccccttg
gctatgaattacttggacaggtttttgtccttcgagcccctcaagaagagccggttgcag
ctgctgggagcgacctgcatgttcgtggcttcgaaaatgaaggaaaccatcccgctgacg
gcagagaagctgtgcatttacaccgacaactccatcagacccgacgaattactgcaaatg
gagctgcttctggtgaataagctgaaatggaatctggctgcagtgacccctcacgatttc
attgaacatttccttactaaaatgcctctgactgaggacaccaagcagatcatccgtaaa
catgcccagacttttgtggctctgtgtgctacagatgttaagtttatttcgaacccaccc
tccatgatcgcagctggcagcgtggtagcagctgtgcaaggccttcacctgggaaacact
aacactttcctctcctatcagtgcctcacacacttcctatcacaagttatcaaatgtgac
ccggactgtttacgagcctgccaagaacagattgaatccctcctcgaatccagtctacgc
caggcacagcaacacaacatatcttcagaaacaaagactgttgaggatgaggcagatctt
tcctgcacgccaactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system