KEGG   Alligator sinensis (Chinese alligator): 102379226
Entry
102379226         CDS       T02922                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X2
  KO
K08774  transforming growth factor, alpha
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04010  MAPK signaling pathway
asn04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102379226 (TGFA)
   04012 ErbB signaling pathway
    102379226 (TGFA)
SSDB
Motif
Pfam: EGF Adeno_E3_CR2 DUF1180 TMEM154 Insulin_TMD UPF0560
Other DBs
NCBI-GeneID: 102379226
NCBI-ProteinID: XP_006032959
UniProt: A0A1U7S199
LinkDB
Position
Unknown
AA seq 159 aa
MVSAAGELALIALGFLLPVCHALENTTSALNGPPVAAAVRSHFNACPDSHSQFCFHGTCR
FLVQEDKPACICHSGYVGTRCEHADLLAVVAANQKKQTITALVVVSVVASVVLIVVCVLI
HCCRVRKHCEWCRAFVCRHEKPGGLLKGGASCCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtcagcgcggccggggagctggcgctcatcgcgctgggttttttattacctgtgtgt
catgccctggagaacacgacatctgccttgaatggtcctccagtggcggcagcagtcaga
tcccattttaatgcttgccccgattcccacagtcagttctgcttccatgggacctgcaga
tttttggtgcaagaggataagccagcatgcatctgccattctgggtatgtcgggacgcgc
tgcgagcatgcagacctccttgccgtggtagctgccaaccagaagaaacaaaccataact
gccttggtggtggtgtcagtggtagcatcagtcgtacttattgtggtgtgtgtgctaata
cactgctgtcgggtaaggaagcattgcgagtggtgccgagcttttgtctgcagacatgag
aagcctggtgggctcctgaaggggggagcttcttgctgtcattcagagacagtggtctga

DBGET integrated database retrieval system