KEGG   Alligator sinensis (Chinese alligator): 102379358
Entry
102379358         CDS       T02922                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04012  ErbB signaling pathway
asn04068  FoxO signaling pathway
asn04110  Cell cycle
asn04115  p53 signaling pathway
asn04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102379358 (CDKN1A)
   04068 FoxO signaling pathway
    102379358 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102379358 (CDKN1A)
   04115 p53 signaling pathway
    102379358 (CDKN1A)
   04218 Cellular senescence
    102379358 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102379358
NCBI-ProteinID: XP_025061796
UniProt: A0A3Q0GPW1
LinkDB
Position
Unknown
AA seq 199 aa
MANCLFDCSDLVFCKIFWQRAPQVHCVVIKKVWLSPAPCQWKTSPAGNMPLSQSNLRQTP
CSRKSCRNLFGPVDHEQLQSDFQDSMRKNLEEAQFKWNFDFETETPLEGAFKWERVPFPD
MSSEYLCSHSKVSGENSRSTSTLKIPTKDLLNRPFSGETIQQVSEANRASSPRRLKRRQT
TIKDFYSAKRKISSSKPNP
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcgaactgcctctttgactgctctgatctggtcttctgcaaaatcttttggcaaaga
gctccccaggtgcactgtgtcgtgataaagaaggtgtggctttcaccggccccgtgccaa
tggaaaacgtcaccagctgggaacatgcctctgtcacagagcaacctccggcagaccccc
tgcagcaggaaaagctgcagaaacctctttggcccagtggatcatgagcagctccagagc
gactttcaggactcgatgaggaaaaacctggaagaagcccagttcaagtggaattttgac
tttgaaactgaaacgccgctggaaggtgccttcaagtgggagagggtcccgtttccagac
atgtcttccgagtacctctgcagccactccaaagtctctggagagaacagtagaagcact
tccaccctcaagattcccacaaaagatctccttaatcggcccttctcgggtgaaaccata
caacaggtctctgaggccaatcgggccagctctccaaggcgcctgaaacgcagacagacc
accattaaagatttctacagtgcaaagcggaagatctcatccagcaagccaaatccctga

DBGET integrated database retrieval system