KEGG   Alligator sinensis (Chinese alligator): 102379461Help
Entry
102379461         CDS       T02922                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00052  Galactose metabolism
asn00500  Starch and sucrose metabolism
asn01100  Metabolic pathways
asn04142  Lysosome
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102379461
   00500 Starch and sucrose metabolism
    102379461
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102379461
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asn04147]
    102379461
Enzymes [BR:asn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102379461
Exosome [BR:asn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102379461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102379461
NCBI-ProteinID: XP_025068164
LinkDB All DBs
Position
Unknown
AA seq 915 aa AA seqDB search
MSRGDTCITRKMKSYQKLTTDVPQPAASRVEEEGVDGKPSCFQKLSTWWLGGCLLAVAIL
LSAGTVWVLRQASKGRHAQTPPEKCSSVTEPLRFDCYPERNVVVTQELCEARGCCFIERD
QASGSRQGVPWCFYPPDFPSYVLESLNQTELGMVGLLRRKVKAYYPRDIETLQLSVEFET
DTRLHIKITDSSSPRYEVPLQVPRAMKRAENPAYSLDFSREPFGLVLKRRASGAVLLNTT
VAPLIFADQFLQISTTLPSTFLYGLGEHRSTFLHSLDWNTLTLWARDVPPTESYNLYGSH
PFYLLLEEGGAAHGVFLLNSNAMEVALQPAPSLTWRTIGGTLDFYIFLGPDPNMVIQQYQ
QVIGLPAMPPLWGLGFHLCRWGYGTSNETWQTVKAMRNYQIPQDAQWNDIDYMEGNRDFT
FDPQAFSTLPQLVEDLHKHGQHYVMILDPGISSTNPRGSYWPFDEGLRRGIFINTTEGQP
LIGQVWPGLTAFPDFSNQDTHQWWLENLKRFHAYVPFDGLWIDMNEPSDFMDGSVDGCPA
GDLDRPPYVPAVLGGSLSAKTLCASAKQNASVHYNLHNLYGLMEAKATASALIQIRGKRP
FVISRSTFPSQGRYSGHWLGDNRSEWKDMSWSIPGLLSFSLFGIPLVGADICGFSGTTSE
ELCARWMQLGAFYPFARNHNTQNEKAQDPTVFNSEVRTAMKEVLLTRYFFEFPQDTVTYS
IDRQFLWGESLLVTPVLEPGADSVIGYFPRGLWYDYYTGSSVNSSGEMLKMAAPLDHINL
HIREGAVLPTQKPETTSGASRGNPLRLVAALSLNAVAWGDLFWDDGESLDTFEKDNYSYL
VFNVTQNVFTSTVLHANVEATYVTVDTLTVYGVRGPPTRVTVNGEEHPFSYLDNQVLTVS
DLHLSLSQGFSIRWM
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagaggagacacgtgtatcacaaggaagatgaagtcctatcagaagctgacaaca
gatgtcccccagccggctgcatcccgcgtggaagaggagggcgtggatgggaagccctcc
tgctttcagaagctgtccacgtggtggctgggtgggtgtctgctggcagtggccatcctc
ctgagcgctggcaccgtctgggtgctcagacaggcctccaagggccggcacgctcagacg
ccaccggagaaatgcagctcggtcactgagccgctgcgctttgactgctaccccgagagg
aacgtggtggtgactcaggagctctgtgaggccaggggctgctgcttcattgagagggac
caggcctcaggcagcagacaaggagtgccatggtgcttttacccccccgacttccccagc
tacgtcttggaaagcctgaatcagacggagctgggaatggtgggcttgctgaggaggaag
gtaaaggcctattaccccagagacattgagacgctgcagctgagcgtggagtttgagaca
gacactcggttacacataaagatcaccgattccagcagccctcggtatgaagttcccctg
caggtccctcgggccatgaagagagcggagaaccctgcctacagcctggatttctccagg
gagccgtttgggctggtgctgaagcgcagagcatcaggggctgtgctgctgaacacaact
gtggctcccttgatcttcgctgaccagtttcttcagatttccaccaccctcccttccaca
tttctctacggacttggggaacaccgtagcaccttcctgcacagcctggactggaacacc
ctgactctctgggctcgggacgtccctcccacggagtcatacaacctgtatggatctcac
ccgttctacctgctgctggaggaagggggagcagcacatggtgtcttcctcctaaatagc
aacgcaatggaggtggccctgcagccggcccccagcctgacctggagaaccatcgggggc
accttggatttctacatcttcctgggtccggatcccaacatggtcatccagcagtaccaa
caggtgataggtctccctgcaatgccacctctctgggggctcgggttccatctgtgccgc
tggggctatgggacaagcaatgagacctggcagaccgtgaaagccatgaggaactaccag
ataccacaggatgctcagtggaatgacatcgattacatggaagggaaccgagacttcacc
ttcgatcctcaggcattcagcacactcccccaattggtggaagacctccataagcatggc
cagcactacgtcatgatcctggaccctgggatcagcagcactaatcctcgcggatcttac
tggccgttcgacgaaggtttgaggcgtggaatatttataaataccaccgaggggcaacca
ctgattggacaggtgtggcccggcctcactgccttcccagacttctccaaccaggacaca
caccagtggtggctggagaacctgaagcgcttccatgcttatgtcccctttgatgggctt
tggattgacatgaatgagccgtctgacttcatggatgggtcggtggatggctgtcctgca
ggggaccttgacaggccgccatacgtgcctgctgtgctaggagggtccctctctgcaaag
actctctgtgcttcagcaaagcagaacgcttctgtgcactacaacctccacaacctctac
gggctgatggaagccaaagccacagccagtgccttgatccaaatccgagggaaacgccct
ttcgtgatctcccgctccaccttccccagtcagggcaggtactcagggcactggctcggt
gacaacaggagcgagtggaaggacatgtcgtggtcaatcccaggcctgctgagcttcagc
ctttttgggatcccgctggtcggggcagacatctgtggcttctcaggcaccacctcagag
gagctctgcgctcgctggatgcagctcggcgccttctacccctttgcccgaaaccacaac
acccagaatgagaaggcccaagaccccacagtgttcaactcggaagtacggacagccatg
aaggaggtgctgctgacacgctacttttttgagttcccgcaggacacggtcacgtactcc
attgatagacagttcctgtggggggagagcctgttggtgacaccagtgctggagcctgga
gcagactcggtgattggctacttcccccgagggctgtggtacgactactatacgggctcg
tctgtgaacagcagcggggagatgctgaagatggcagctccgctggaccacatcaacctg
cacatccgggagggtgccgttctccccacccagaaacccgagaccaccagcggggcaagc
cgggggaatccactgcgcctggttgcagctttatccctgaacgctgtcgcctggggggac
ctcttctgggacgacggtgagagcctggacaccttcgagaaggacaactactcctacctg
gtgttcaacgtcacacagaacgtcttcacctccaccgtcctccacgccaacgtggaagcc
acctacgtcactgtggacacgctgacggtctacggggtccggggtccgcccacaagagtc
accgtcaatggtgaagagcatcccttctcctacctggacaaccaggtgctcacggtgagc
gaccttcacctcagcctgagccagggcttctccatcaggtggatgtga

DBGET integrated database retrieval system