KEGG   Alligator sinensis (Chinese alligator): 102379663Help
Entry
102379663         CDS       T02922                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X2
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102379663 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:asn03036]
    102379663 (HDAC4)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102379663 (HDAC4)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102379663 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 102379663
NCBI-ProteinID: XP_014373672
UniProt: A0A1U8CX81
LinkDB All DBs
Position
Unknown
AA seq 1118 aa AA seqDB search
MSSQNHPDGLSARDQPVELLNPPRVNHMPSSVDVTATLPLQVAPTSVPMDLRLDHQFSMP
VTEPTLREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLEQHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRFWKTQHSSLDQSSPPQSGVSGTYNHPVLGMYDSKDDFPLR
KTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACNSAPGSGPSS
PNNSSNNISAENGITGSVTSIQAETSLAHRLVNREGSVTQLPLYTSPSLPNITLGLPATG
PSSGGSGQQDAERLAIPTLQQRISLFPGTHLTPYLSTTTLERDGGTAHNPLLQHMVLLEQ
PTAQTPLVTDWYLSGLGALPLHAVVSGDRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQQ
LVIQQQHQQFLEKHKQQFQQQQLHINKMIPKPTEPTRQHESHPEETEEELREHQALLEEP
YSDRVSSQKVVQGLANMVQVKQEPIESDEEETEPQQELEPGQRQAEQELLFRQQALLLEQ
QRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYD
TLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAH
TLLYGTNPLNRQKLDSKKLLGSLTSMFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVI
ELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDW
DVHHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLD
PPMGDTEYLTAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQ
LMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPERVFQQRANANAVQSMEK
VIEIHSKYWHSLQRYASTVGYSLIEAQKCENEEAETVTAMASLSVGVKPAEKSCHLLNPS
MMHLSSTSKRPEVVPPQRITWLPSQWGWPRRISAVLFL
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaaatcatccagatggactttctgcccgagaccagccagtggagctgctg
aatccacctagagtgaaccacatgcctagttctgttgatgtgactgcaacactgcccttg
caagttgcaccaacttcagttcctatggacctccgtttggaccatcagttttccatgcct
gtgacagagccaacgctccgtgaacagcagctccagcaagagctcctggctctcaaacaa
aaacaacaaatccagagacaaatcctcattgctgagttccagaggcagcatgaacagctc
tctcggcagcatgaggcccagctacacgagcacataaaacaacagcaggagatgctagca
atgaaacatcagcaagaactcttggagcaccagaggaagttggaacaacaccgacaggag
caggagctagagaagcagcatagagaacagaaactacagcagctcaaaaataaagagaaa
ggaaaagaaagtgcagtggcaagcacagaagtaaaaatgaaattacaagagtttgtcttg
aataaaaagaaggctttggcacaccggaatctcaaccattgcatttccagtgatccccgc
ttctggaaaacacagcatagttctcttgaccagagttcacctccccaaagtggagtatca
ggtacctataaccaccctgtactggggatgtatgattccaaagacgactttccactcaga
aaaacagcttctgaacccaatctgaaattacgatccaggctaaagcaaaaagttgctgaa
agacggagcagcccattgttacggagaaaagatggcccagtggttactgctcttaagaag
cgtccattggatgttacagactctgcatgcaacagtgctcccggatctggtcccagttct
ccaaacaacagctccaataacataagtgctgagaatggaattacaggatcagtcacaagt
attcaggcagagaccagcttggctcacagactagtgaatcgcgaaggttcagtaacacag
cttcctctctacacatctccttccttacccaacataacattaggactgcctgcaactggc
ccttccagcgggggatcaggacagcaggatgctgagagacttgctattccaaccttacaa
cagaggatctctttatttcctggcacccaccttactccctatttgagcactacaacgttg
gaaagggatgggggaactgcacacaaccctctcctgcaacatatggtcttactggaacaa
ccaactgcacaaacgcccttagtcacagactggtatctttcaggactgggggcactgccc
ctccatgcagtggtcagtggagatcgggtctccccctcaattcacaagctccggcagcac
cgcccgctggggcgcacgcagtctgctcccctgccccagaacgcccaagccctccagcag
ttagtgatccagcagcagcatcagcagtttctggagaaacacaaacagcagttccagcaa
cagcaactgcacattaacaagatgataccaaaacctaccgagccaactcgccagcatgaa
agccaccctgaggagacggaagaagaattacgagaacaccaagcacttttggaggagcca
tacagtgacagagtttcgagtcaaaaggtggtgcaagggttggccaatatggtgcaggtg
aaacaagaacccattgagagtgatgaagaggaaacagagccacaacaggagctagagcct
ggccagaggcaagctgaacaggagctgctgttccgccagcaagcccttttactggagcag
caacgcattcaccagctgagaaactaccaagcatcaatggaggcagctggcatcccagtg
tcttttggagggcaccggcctctgtcccgggcacagtcctcacctgcttctgccaccttt
cccatgtctgtacaggagccacccactaagccaaggttcacaacaggccttgtatatgac
accttgatgctgaaacaccagtgtacctgtggaaacacaaacagccacccagagcatgca
gggagaatccagagcatctggtcccgccttcaggagacaggcctccgtggcaaatgtgag
tgcattcgtggaagaaaagcaactctagaagagctacagacagttcactcagaggcccat
acactgctgtacggaacaaaccctctgaacaggcagaaactggacagcaagaaacttcta
ggttctctaacatcaatgtttgtcaggctcccttgtggtggtgttggagttgacagtgac
acaatttggaatgaggttcattcatctggtgctgctcgcttggctgtgggctgtgtcatt
gaacttgtttttaaagtggccacaggagaattaaagaatggatttgctgtagttcgacct
ccaggtcaccatgcagaagaaagtacacccatggggttttgctattttaattctgtggca
attgcagccaagcttctccaacagagactgaacgttagcaaaatccttatagtggactgg
gatgtacaccatggaaacggtactcagcaagctttctacaatgaccctaacgttctttat
atttcactacatcgctatgatgatgggaacttcttcccaggcagtggagctcctgatgag
gtcggcacaggaccaggtgttggtttcaatgttaatatggcctttactgggggccttgat
ccaccaatgggagatacagaatacttgactgctttcagaacggtagtgatgccaattgcc
aatgaatttgccccagatgttgtgctggtatcatctggttttgatgccgtggaaggtcat
cctacacctcttggagggtataatctatcagcaaaatgctttgggtacctgacgaagcag
ctgatgggattggccggaggtcgaattgttctggcccttgaagggggtcatgacctgaca
gccatttgtgatgcatctgaagcatgtgtttctgctttgctgggaaacgagcttgatcct
cttccagaaagggttttccagcagcgagcaaatgctaatgccgtgcagtccatggaaaaa
gttattgagatacacagcaagtattggcattcactccagcgttatgcctccacggtaggg
tactccttgattgaggcacagaagtgtgagaatgaagaagcagaaactgtaacagccatg
gcatccttgtcagtaggtgtgaagccagctgaaaagagttgtcaccttctgaacccaagt
atgatgcacctgagctccaccagcaagagaccagaggttgttccaccacaacgcatcaca
tggcttccaagccagtgggggtggcccaggagaatatcagcagttttgtttctttga

DBGET integrated database retrieval system