KEGG   Alligator sinensis (Chinese alligator): 102380189Help
Entry
102380189         CDS       T02922                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102380189 (SETDB2)
Enzymes [BR:asn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102380189 (SETDB2)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102380189 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102380189 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD D5_N
Motif
Other DBs
NCBI-GeneID: 102380189
NCBI-ProteinID: XP_006030263
UniProt: A0A1U7SGV6
LinkDB All DBs
Position
Un
AA seq 716 aa AA seqDB search
MHDTCVQLLQRMEQTKSDLQTVWREMEDERVDFIFEQMQNLLLSLKQKIKDGSATSKECF
QACMLLKEANLSNLFTSTNVNDVTDEDTMQKSESRLQPSESNGNRTDTEDNSLLNMEEKE
KSCSENEEAANEIMELPLTLPYQNHNCSNACLANRPLNSYKSENPLKIPILCQFQRRHAK
ADCLSKSHDVNYKAPCGKSLRNFEEVQNYLLETECDFLSVDHFSFNTYVQLGRNTVNQEP
LVFDFDISSGAEVVPISFCNDIDRTRLPFFKYRKASWPRGYYLNNFSSTFVDSCDCTNGC
KNRLKCACLQLTARGFSESSMSPNKVLCGYKHKRLEMPITSGIYECNVSCRCNRMLCQNR
VVQHGIQVRLQVFNTEKKGWGVRCLDDIDKGTFVCTYSGRLMSRAESQETGDVNHEDNEQ
DAESGRSHSSLPKKRRGDAACSDSEIELVQTGKGALHVEYEPLTQPLDAENKPPELQNNG
CNPNNLINSGVRRPKARIDFLHNHQPELGVDTLAHDATSDEDSSLSQQSTKLKPTTGTRR
RKGKLNLRQELEDLEETMQVESVVSLGAKCKEGTSPQDLAHGKLVTQGDAYAVKKDRALF
QKSEFKEENCKSSKQDPFCHETLLKNSDQENIYLLDATKEGNVGRFLNHSCCPNLFVQSV
FVETHNKNFPWVAFFTNRHVKSGTELTWDYGYEAGSMPETEIPCQCGVQKCRKKIL
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgcatgatacgtgtgtacaactactccaaaggatggaacaaactaaaagtgacttacag
acggtttggagggagatggaagatgaaagagtggactttatatttgagcagatgcaaaac
ctgttgctgtctctgaaacaaaagatcaaagatggaagtgcaacaagcaaagagtgcttc
caagcttgcatgctgttgaaagaggctaatctaagcaatcttttcacatcaacaaatgta
aacgatgtgactgatgaagataccatgcagaaaagcgaatctagattacagccttctgaa
tcaaatggaaatagaacagatacagaagacaattctctcttgaacatggaagagaaggaa
aagtcatgttcagagaatgaagaggcagctaatgaaatcatggagttacctttaacattg
ccttatcagaatcacaattgctctaatgcatgtcttgccaacagaccactgaactcctac
aagagtgaaaacccccttaagataccaatcctgtgtcagttccaaagacgacatgcaaaa
gcagactgtctttccaagtcacatgatgtgaattataaagccccctgtgggaagagtctg
agaaattttgaagaggtgcagaattacctgcttgaaacagagtgtgacttcttatctgtt
gatcacttttccttcaacacatatgtacagctgggcaggaacactgtaaaccaagaacca
cttgtatttgattttgatatcagcagtggagctgaggtggtgcccatttccttctgcaat
gacattgaccgtacaagattacctttctttaaatacagaaaggcatcatggccacgtgga
tactatctgaacaacttttccagcacgtttgttgattcatgcgactgtacaaatggctgc
aaaaataggttaaaatgtgcatgcctacagctgactgcaagaggctttagtgaaagttcc
atgtcgccaaataaagtactttgtggatataagcataaaagactggagatgcccattact
agtggaatttacgaatgtaacgtatcatgcaggtgtaaccgaatgttgtgtcagaacaga
gtagtacagcatggcatccaggttcggttacaagtgtttaacacagaaaagaaaggctgg
ggagtccgctgccttgatgatattgacaaaggaacatttgtttgcacttactcaggcagg
ctgatgagcagagctgaatctcaggaaacaggtgatgttaatcatgaggataatgaacaa
gatgccgagagtggcagaagtcacagctcacttccaaaaaaaagaagaggggatgctgct
tgttcagattctgagattgagcttgtgcagactggtaaaggtgctcttcatgtggagtat
gaacctttgactcaacctttagatgctgaaaacaaaccacctgaacttcagaataatgga
tgtaatccaaataatttgatcaactctggtgttagaagacctaaagccagaatagatttt
ctccacaatcaccagccagaactgggagttgatacactggcacatgatgccacctcggat
gaagatagctctttatcccagcagtcaaccaaattgaaaccaaccactggaaccaggaga
agaaaaggaaaactaaacctgcgacaggagctagaggatctggaggagaccatgcaggtt
gaatctgttgtcagccttggtgcaaagtgcaaagaggggacatctccacaggatcttgca
catggtaaattggtcacacaaggtgatgcttatgctgtgaaaaaggacagggctctattc
caaaagagtgagttcaaagaagaaaactgtaagagctccaaacaagatcctttttgtcat
gagacgcttctgaagaattctgatcaagaaaacatttatttgttggatgccacaaaagaa
ggaaatgtgggtcgatttcttaatcatagctgctgcccaaatctctttgtgcaaagtgtc
tttgtagagactcacaacaagaatttcccctgggtggcattcttcacaaacaggcacgtg
aaaagtggaactgaactcacgtgggattatggttatgaagctggaagcatgccagagact
gagatcccctgtcagtgtggcgttcagaagtgcaggaaaaaaattttatag

DBGET integrated database retrieval system