KEGG   Alligator sinensis (Chinese alligator): 102380268Help
Entry
102380268         CDS       T02922                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X4
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn03030  DNA replication
asn03410  Base excision repair
asn03420  Nucleotide excision repair
asn03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:asn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102380268 (LIG1)
   03410 Base excision repair
    102380268 (LIG1)
   03420 Nucleotide excision repair
    102380268 (LIG1)
   03430 Mismatch repair
    102380268 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:asn03032]
    102380268 (LIG1)
   03400 DNA repair and recombination proteins [BR:asn03400]
    102380268 (LIG1)
Enzymes [BR:asn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102380268 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     102380268 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102380268 (LIG1)
DNA replication proteins [BR:asn03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102380268 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102380268 (LIG1)
DNA repair and recombination proteins [BR:asn03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102380268 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     102380268 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     102380268 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 102380268
NCBI-ProteinID: XP_006030431
UniProt: A0A1U7SH82
LinkDB All DBs
Position
Unknown
AA seq 954 aa AA seqDB search
MQRSIMSFFQPVKGAKAEESRPLEDEHATKKMPEKAEKQSNGLGHCANSPVKPIGKRSLR
RIIESDSEEEEPEPAVIAEEGQMQVETPKKASSKQELVHPAQSELSADSPSPSSSQSAKN
SSDGTDTTHSDIPRRRTARKQMPRSKIEMATSRENGHPKEPVAKRLREEPDPKDETGERA
KVAAESMEMQEVKGQSSEEELTKGKGTSGEAAGNKDKIDKTGGEAAAQKKSEPSKPSRAI
SNFFAPRKAPLAKTETGEASAATTTDKSSVLKGSAAASGKQGNQMNTSSSEAAVLLDPVE
YNPSKSSYHPVQDACWGPGQRVPYLAVARTFERIEEVSARLKNIETLSNLFRSVIALSPC
DLLPCIYLCLNHLGPAYEGLELGIGESILMKAVAQATGRQLDKIKAEAQEKGDLGLVAES
SRSNQRTMFAPPKLSAIGVFNKFQEIARMTGSASMNKKIDIIKGLFVACRHSEARYVARS
LSGKLRIGLAEQSVLSAIAHAVSLTPPGQSCPPEVLDASQGKSADVRKTWLEEQAQILKQ
IFCELPNYDIIVPVLLEHGMESLPQYCKITPGIPLKPMLAQPTKGIGEVLKRFEEAAFTC
EYKYDGERAQIHILENGDVYIYSRNQENNTSKYPDIVSRIPKVKKDSVQSCILDTEAVAW
DPEKKQIQPFQVLTTRKRKDVEAAEIKVQVCLYAFDMLYLNGESLVKQPFSRRRQLLHEL
FVETEGEFLFATSMDTCNTDEISEFLDQSIKDSCEGLMVKTLDVDATYEIAKRSHKWLKL
KKDYLEGVGDTLDLVVIGAYLGKGKRVGMYGGFLLACYDEESEEYQSICKIGTGFSEETL
EKHYSFLKDLVLEKPRAYYRWDSSAEPDHWLDAVQVWEVKCADLSISPVHKAAIGLVDEE
KGISLRFPRFLRVRDDKTAEEATTSTQVAELYKKQQQIQNQQLAGRGEGEDDFY
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgctccattatgtcatttttccagcctgtgaagggagcaaaggcagaggagagc
agacctctagaagatgagcatgcgactaaaaagatgccagagaaggctgagaagcagagc
aatggtcttggtcactgtgcaaactctccagtgaagcctataggcaagaggtccttgcgc
cgaatcattgagagtgacagtgaagaggaggagcctgagccagcagtcatagcggaggag
gggcagatgcaggttgagactcctaagaaagccagcagcaagcaggagctggtgcaccct
gctcagtctgagctctctgcagacagcccgtcaccaagcagcagccagtctgctaaaaac
agttctgatgggactgacaccacccactctgacatccccaggcgcaggactgctcgcaag
cagatgcccagaagcaaaatagagatggcgacaagcagagagaatggccaccccaaagaa
ccagtcgccaaaagattgagagaagagccagacccaaaagatgagactggtgagagagca
aaggttgcagcagagtctatggagatgcaagaggtgaaagggcagagttcagaggaagag
ttaaccaagggtaagggcacctcaggggaagcagctggtaacaaggacaaaattgacaaa
actggaggagaagcagcagcccagaagaaatctgagccttccaagcccagcagagccatc
tccaacttctttgcccccaggaaggcaccattggcaaagacagagacaggagaagctagt
gcagccaccacaacggataagtcttctgtcctgaagggctctgctgcagcaagtggcaag
cagggcaaccagatgaataccagttcttctgaggctgctgtgctgctggatcctgtggag
tacaatccttcgaagagcagctaccaccctgtccaggatgcctgctggggtcctgggcag
agggtcccctacctggcggtagctcgtacctttgagagaattgaggaggtgtctgcccga
ctgaagaacattgagactctgagcaacctcttccgatcggtcatcgccttgtccccatgt
gacctgctgccctgcatctacctctgcctgaaccacttgggcccagcctatgaggggcta
gaactgggcattggcgagagcatccttatgaaagctgttgcacaagctacaggtcgacag
ttggataagatcaaggctgaggcccaggagaagggtgacctgggtctggtggcagagagc
agccgcagcaaccaacgcactatgttcgcaccacccaagctgagtgccattggggtcttt
aacaagttccaggaaatcgctaggatgacaggcagtgcttctatgaacaagaagattgac
atcatcaaggggttgtttgttgcctgtcggcactcagaagcccgctacgtagctagatca
ctgagcgggaagctccggatcgggttggcagagcagtcagtgttgtcagccattgctcat
gctgtgtctctcactcccccaggacaaagctgccctccagaggtgctggatgcaagccag
ggcaagtctgcagacgtacgcaaaacctggctggaggagcaggcccagattctcaaacag
atcttctgtgagctgccaaactatgacatcattgttcctgtcctgttagagcatggaatg
gagagcctgccacagtactgcaagatcaccccagggatcccactgaagcccatgctggcc
cagcccaccaagggcataggggaggtactgaagcgctttgaggaggctgccttcacttgc
gagtacaagtatgatggggagcgagcccagatccacatactagagaatggggatgtgtac
atctacagccgcaaccaagagaataatacctccaagtaccctgatattgtcagcaggatc
cccaaggtgaagaaagacagcgtgcagtcatgtatcctggacacagaggctgtggcctgg
gaccctgagaagaagcagatccagccgttccaggtgttgactacccggaagcggaaagat
gtggaagctgctgagatcaaagtgcaggtgtgtctgtatgccttcgacatgctgtacctc
aatggagagtccctggtgaagcagcccttctccaggcgccggcagctgctgcatgagttg
tttgtggagacagagggggagttcctgtttgccacttccatggacacatgcaatacagat
gagatctcggagttccttgaccagtccatcaaagactcctgtgaggggctcatggtcaag
accctggacgtggatgccacatatgagattgccaagagatcccataaatggctgaagttg
aagaaggattacctggagggtgttggagacacactggacttggtggtgattggtgcctac
ttagggaaaggcaagcgtgtgggcatgtatggaggcttcctgctggcctgctatgatgag
gagagtgaggagtaccagagcatctgcaagataggaactggcttcagtgaagagaccctg
gagaagcattacagttttcttaaggaccttgtattggagaagccaagagcttattaccgc
tgggacagcagtgcagagcctgaccactggctagatgcagtgcaggtgtgggaggtgaag
tgtgctgacctgtccatctcgcctgtgcataaggcagctattggcctggtagatgaggag
aaaggtatctccttgcgctttccccgctttctgcgtgttcgtgatgacaagacggctgag
gaagccactaccagcacccaggtagctgaactctacaagaagcagcagcagattcaaaac
cagcagctggcagggaggggtgagggagaagacgacttctattaa

DBGET integrated database retrieval system