KEGG   Alligator sinensis (Chinese alligator): 102381312
Entry
102381312         CDS       T02922                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04068  FoxO signaling pathway
asn04217  Necroptosis
asn04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102381312 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102381312 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102381312 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:asn03000]
    102381312 (STAT3)
Transcription factors [BR:asn03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102381312 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 DUF4795 Fib_alpha AP1AR Baculo_PEP_C Syntaxin-6_N
Other DBs
NCBI-GeneID: 102381312
NCBI-ProteinID: XP_025063093
UniProt: A0A3Q0GY41
LinkDB
Position
Unknown
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKTLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEDAFGKYCRPESQEHPEATDPGSAAPYLKTKFICVTPTTCS
NTIDLPMSPRTLDSLMQFGNNSEGAEANAGGQFESLTFDMELTPECASSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacacccggtacttggagcagctccaccag
ctctacagtgacagcttccccatggagctgcggcagttcttggccccctggattgagagc
caggactgggcctacgctgccagcaaggagtctcacgccacgctggtgttccacaacctg
ctgggtgagatcgatcagcaatacagccgcttcctgcaggagtccaacgtcctctaccag
cacaacctgcgcaggatcaagcagtttctgcagagcaggtacctggagaaaccaatggaa
attgcccgcattgtagctcggtgtctgtgggaagaatctcgccttctccaaacggctgca
accgcagctcagcaaggtgggcaggcaacacaccccacagctgctgtagtgacggagaaa
cagcaaatgctggagcagcatctgcaggacgtgaggaagagggtgcaggatcttgagcaa
aagatgaaggtagtggagaacctccaggatgactttgacttcaactacaagaccctgaaa
agtcaaggagacatgcaggatctgaatggaaataatcagtcagtgacacggcagaaaatg
cagcagctggagcagatgctgacagcactcgaccaaatgcgcagggggattgtgagcgaa
ctggctgggctcctatcggccatggagtatgtgcagaaaacactggcagatgaggagctg
gctgactggaagagaaggcagcagattgcgtgcattgggggccctcccaacatctgtctg
gatcgcctggaaaactggatcacatcccttgctgagtcacagctgcagacccgccagcag
atcaagaaactggaggagctacagcaaaaagtgtcctacaaaggagatcccatagtccag
catcggcccatgctggaagaaaggattgtggagctgttcaggaacctaatgaaaagtgcc
tttgtcgtggagaggcagccctgtatgcccatgcacccagatcgccccctggtcatcaaa
actggtgtgcagttcaccaccaaagtcaggttgctggtcaaatttccggagctgaactat
cagctgaagatcaaggtgtgcattgacaaggactccggtgatgttgcagcactcaggggc
tcccggaagttcaatatcctggggacaaacaccaaggtcatgaacatggaggagtccaac
aatggcagtctttccgcagagttcaagcacttgacactgcgggaacaaaggtgtggcaat
gggggcagagccaactgtgatgcctcactgatagtcactgaggagctgcatctcatcacc
tttgagacagaggtttatcaccaaggcctgaagatcgacttggagacccactcgctgcct
gtcgtggtcatttcgaacatctgccagatgccgaatgcctgggcgtctatcctatggtac
aacatgttgaccaacaaccccaagaatgtgaacttcttcaccaagccgccaattggcaca
tgggaccaggtggctgaggtgctgagctggcagttctcttccaccaccaagcggggcctc
agcatcgagcagctcacaacgctggcagagaaactcctaggcccaggtgttaactactct
gggtgccagatcacatgggccaaattctgcaaggagaacatggctggcaaagggttttcc
ttctgggtctggctggacaacatcattgacctcgtgaagaaatatatcctggctctgtgg
aatgaagggtacatcatgggattcatcagcaaggagcgtgaacgagccatcctgagcacc
aaaccaccaggtaccttcctcctgaggttcagcgagagcagcaaggaaggcggcatcacc
ttcacttgggtggagaaagacatcagtgggaagacccagatccagtcggtggagccgtac
acaaagcagcagctcaacagcatgtcgtttgcggaaatcatcatgggctacaagatcatg
gacgcgaccaacatcctggtctcgcccctggtatacttgtaccctgacatccccaaggaa
gatgccttcgggaagtactgccgtcccgagagccaggagcaccctgaagccacagaccca
ggtagtgctgctccatatctgaagactaagttcatatgtgtcaccccaacgacctgcagt
aacaccattgacctgccaatgtccccacgcacgctggactcgctcatgcagtttgggaac
aacagcgagggagcggaggccaacgcaggaggccagtttgagtctctgacctttgacatg
gagctgactccagaatgtgcctcctcacccatgtga

DBGET integrated database retrieval system