KEGG   Alligator sinensis (Chinese alligator): 102381953Help
Entry
102381953         CDS       T02922                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00052  Galactose metabolism
asn00500  Starch and sucrose metabolism
asn01100  Metabolic pathways
asn04142  Lysosome
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102381953 (GAA)
   00500 Starch and sucrose metabolism
    102381953 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102381953 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asn04147]
    102381953 (GAA)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102381953 (GAA)
Exosome [BR:asn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102381953 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil GHL15 Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102381953
NCBI-ProteinID: XP_025050527
LinkDB All DBs
Position
Unknown
AA seq 857 aa AA seqDB search
MGYVCSRDREGEHLVSKGECEARGCCYVPVLAPGSGGWQPWCFFPPGYPSYRLQNLTATE
TGYTASLTRAAASVFPGDVVVLQLDVRFETDARLHFTLRDPANKRYEVPLETPTASSRAV
SKLYSLQFSADPFGLIVLRESSGQVLLNTSVAPLFFTDQFLEISTSLPSRLISGLGEHLT
PLVLDTQWTKITLWNRDMAPVVRGRGEGSPALAGRGVSQSPPGLILELRPQRGLLNSNAM
DVVLQPSPALTWRTIGGILDFYVFLGPDPKSVVRQYLDVIGYPFMPPYWGLGFHLCRWGY
SSSAITRQVVDNMTAAGFPLDVQWNDLDYMDARRDFTFNRRSFPDYADMVRDFHRDGRHY
IMIVDPAISSTSPAGSYKPYDDGLRRGVFIRNATGQPLIGKVWPGPTAFPDFTNPETQEW
WHDVVKEFHDQVPFDGMWIDMNEPSNFVLGSVDGCPSNKLEDPPYVPGVLGGSLRSATIC
ASSQQHLSSHYNLHNLYGLTEAIASHNALVRVRGKRPFVISRSTFAGHGRYAGHWTGDVF
SSWEQLSSSIAEVLLFNLYGVPLVGADICGFTGDASEELCVRWTQLGAFYPFMRNHNDHG
SQPQEPYAFSPAAQKAMRKALLLRYTLLPYLYTLFHKAHVAGETVARPLFLEFPTDPNTW
TVDHQLMWGAGLLITPVLEPGKAKVSGYFPAGTWYHLVTDTVLHSKGQWILLPAPLDTIN
VHVREGHILPLQEPGFTTTESRKKGMTLVVALTADGFALGDLFWDDGEGLQTFERGDYTQ
ILFLAMRGTLVSELLRVNSQVDGLLLQRVAVLGVPSPPQHVLVNGALVDDFSYRTDTEIL
TIQLSLPLGEQFTITWA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgggctatgtttgttcccgagaccgggaaggggagcacctggtctccaagggggagtgc
gaggcgcggggctgctgctacgtccccgttctcgcgccggggtctggcggttggcagccc
tggtgcttcttcccgcccggctaccccagctacaggctgcagaacctgactgccaccgag
acgggctacaccgccagcctgacccgggccgcggccagcgtcttcccgggcgacgtcgtg
gtgctgcagctggatgtgcggtttgagacggacgccaggctccacttcacgctcagggac
ccggccaacaagcgctacgaggtgccgctcgaaaccccgaccgcgagcagccgggcggtc
tcgaagctctacagcctgcagttctcggccgacccctttggcctgatcgttctcagggaa
tccagcgggcaggtcctgctgaacacttccgtggctcccctgttcttcacagaccagttc
ctcgagatctccacctccctgccctcccgcctcatctccgggctgggggagcacctgacc
ccgctcgtccttgacacccagtggaccaaaattaccctctggaaccgggacatggcaccc
gtggtgaggggcaggggcgagggaagccctgccttagcagggaggggagtgtcccagagc
cccccgggtcttatcctagagctcagaccccaaagggggctgctgaacagcaacgcgatg
gatgtggtgctgcagcccagccctgccctgacgtggaggacaattggtggcatcctggac
ttctatgtcttcctgggtccagaccccaagagcgtggtccggcagtacctggatgtcatt
gggtaccccttcatgccgccctactggggcctgggcttccacttgtgccgctggggctac
tcctcgagtgcgatcacccggcaggttgtggacaacatgacggctgcgggcttccccctg
gacgtgcagtggaacgacctggactacatggacgcacggcgggacttcaccttcaaccgg
cgcagcttcccggactacgccgatatggtgcgagacttccaccgcgacggccggcactac
atcatgatcgtggacccggcgattagcagcaccagccctgccggcagctacaagccctac
gacgatgggctgaggcgaggggtgttcatccgaaacgcgacggggcagcctctgattggg
aaggtgtggccgggtccgaccgccttccccgacttcacaaaccccgagacgcaggagtgg
tggcacgacgtggtgaaggagttccacgaccaggtgcccttcgacggcatgtggatcgac
atgaatgagccctcgaactttgtgctgggctccgtggacgggtgccccagcaacaagctg
gaagacccaccttacgtgccaggcgtgctgggggggtccctgcgctcggccaccatctgc
gcctccagccagcagcacctgtcctcgcactacaacctgcacaacctgtacgggctgacg
gaggccatcgcgtcccataacgcgctggtgcgggtgcgaggcaagcgtccctttgtgatc
tcccgctccaccttcgctgggcacggccgctacgccggccactggaccggggacgtcttc
agctcctgggagcagctgtcctcctctatagcagaggtgctgctcttcaatctgtatggg
gtgccgctggtcggagctgacatctgcggcttcacgggagatgcctcggaggagctgtgc
gtgcgctggacccagctgggcgccttctaccccttcatgaggaaccacaacgaccatggc
agccagccccaggagccgtacgcgttcagcccggcagcgcagaaggccatgaggaaggcg
ttgctcctgcgctacacgctgctcccgtatctctacaccctcttccacaaggcccacgtg
gcaggggagaccgtggcgcgacccctcttcctcgagttccctacagaccccaacacctgg
accgtcgaccaccagctcatgtggggtgcgggcctcctcattaccccggtgctcgagccc
gggaaggccaaagtgagcgggtacttccctgcggggacctggtaccacctggtgacggac
accgtcctccacagcaagggccagtggatcctcctgcctgctccgctcgacaccatcaac
gtccacgttcgggaaggacacatcctgcccttgcaggagcctggcttcaccacgaccgag
tcccgcaagaaggggatgacgctggtggtggcactgacagcagacggcttcgccctgggc
gacctgttctgggatgacggcgaggggctgcagacctttgagaggggcgattacacccag
atcctcttcctggccatgcgcggcacgctggtcagcgagctgctgcgggtcaacagccag
gtggatgggctgctgctgcagagggtggcggtgctgggcgtccccagccccccccagcac
gtcctggtgaacggcgccctcgtcgacgacttctcctaccgcaccgacaccgagatcctg
acaatccagctgtccctcccgctgggggagcagttcacgatcacctgggcttga

DBGET integrated database retrieval system