KEGG   Alligator sinensis (Chinese alligator): 102382842Help
Entry
102382842         CDS       T02922                                 

Gene name
KMT5A
Definition
(RefSeq) N-lysine methyltransferase KMT5A isoform X3
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102382842 (KMT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:asn03036]
    102382842 (KMT5A)
Enzymes [BR:asn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102382842 (KMT5A)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102382842 (KMT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET SRP-alpha_N
Motif
Other DBs
NCBI-GeneID: 102382842
NCBI-ProteinID: XP_006015179
UniProt: A0A1U7RIV8
LinkDB All DBs
Position
Unknown
AA seq 328 aa AA seqDB search
MRTLLQALARVCRARGMMERKENVFIGQSKIYTYLNPNKSPGARPPLQEENCVMHHEVKC
QGKTINETCRKGDEKRNAGNPIEGATKPEDQKDKESGCDSSASVPNQNQEAAETRKNMPL
PSNSTDAAKAKQAQKKVVKAKGPRRKAQGKTSQNRKVTDYYPVRRSSRKSKTELQTEEKK
RIDELITNGKEEGMKIDFIDGKGRGVIATKHFNRGEFVVEYHGDLIEITDAKKREAVYAQ
DPSTGCYMYYFQYLSKTYCVDATKETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASR
DIKVGEELLYDYGDRSKASIEAHPWLKH
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgttgttgcaggctctcgcgagagtttgtcgcgcgcgaggcatgatggagaga
aaggagaacgtatttattggtcagtccaaaatctacacctacctgaatcctaacaaatct
ccaggtgctcgtcctccacttcaagaagaaaactgtgtcatgcatcacgaagtgaagtgt
cagggcaaaacaataaatgaaacgtgcagaaaaggagatgaaaaaagaaatgctggtaat
ccaatagaaggtgctacaaaaccagaagaccagaaagataaagaaagtgggtgtgattct
tcagcatctgttcctaatcaaaatcaagaagctgcagaaactcgaaagaatatgcctcta
ccttctaatagtactgatgcagcaaaagcaaagcaagctcagaagaaggtggttaaagca
aaaggaccaaggagaaaagcacaaggaaaaacctcccagaatcgaaaagtgacagattat
tatcctgttagaagaagttccaggaagagtaaaactgaactacagactgaggaaaagaag
agaatagatgaactaattacaaatgggaaagaagaaggaatgaagatagatttcattgat
ggtaaagggcgaggagtaatcgctaccaaacattttaatcgtggagaatttgtagtagaa
tatcatggggatctcatagagatcactgatgctaaaaagcgagaggctgtctatgcacag
gatccatccacaggctgctacatgtactattttcagtacctcagcaaaacgtactgtgtt
gatgctacaaaagagactaatcgtctgggaaggctgatcaatcacagcaaatgtggcaac
tgtcaaacaaaacttcatgacattgatggtgtacctcatctcatactgatagcttcacgg
gacattaaagtgggtgaagaattgttgtatgattatggagacaggagcaaggcttccatt
gaagctcatccatggctgaaacactaa

DBGET integrated database retrieval system