KEGG   Alligator sinensis (Chinese alligator): 102383000
Entry
102383000         CDS       T02922                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04141  Protein processing in endoplasmic reticulum
asn04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:asn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102383000 (ATF6B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102383000 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:asn03000]
    102383000 (ATF6B)
Transcription factors [BR:asn03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102383000 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA ZapB GAS DUF4407
Other DBs
NCBI-GeneID: 102383000
NCBI-ProteinID: XP_025048729
UniProt: A0A3Q0FN37
LinkDB
Position
Unknown
AA seq 603 aa
MDTSPPDPPWDTSPISLFLDLQVKSEPVSPASSHCSDSSSLSSASPPSLSSASDPLAMAP
SLAETLGVKMEQPPTPPCALGDVLAPPSSTVHISLVPPSDAQATPGRPVPITKPEGGLSR
KPPLQPKPLVVTAVPMPPSAPPGQALLLQPLPHGQPPTIAVPAPPVVLSSSELLHLRVSG
LLQVKAAGPEGPPGKPPKPEAKTIVPAPGQVGSCAQEIDMKVLKRQQRMIKNRESACQSR
RKKKEYLQGLEARLHEALAENERLRRENAVLRRRLDGVLSENMELKFGSGNRKVVCIMVV
LLFIAFNFGPISISEQRPGDLEPPGEAVEPGPSRRHLLEVGQEVPVEPTLAPQPDLPPPG
LAQAPFRNLTGPLSGMKDLMLRDLDKFFLASDCRQFNRTESLRLADELSGWVRRHQINRR
KPLQARETPGRQPSPARPEPSSSRYVPASAPRHPERAALSQLQVYQRPGRGQYDFLDAID
RREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLLMPAMALNESVYRAGRDYEVMMQIDCE
VMDTRVIHIKSSTVPPSLRRPQAPAPSDNGTQASSVGARPPRGAPRPARRPPRPLYLSGY
GDG
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggacaccagtcccccggacccgccgtgggacacatcacccatcagcctcttcctggac
ttgcaggtgaagtcggagcctgtctcgccagcctcgtcccactgctccgactcctccagc
ctctcttctgcctctccccccagcctctcttctgcctctgaccccctggcaatggccccc
tccctggcggagacactgggcgtaaagatggagcagccacccactcccccttgcgctctt
ggcgatgtcctcgccccccccagcagcactgtccacatcagcctggtgcccccttcagat
gcccaggctaccccagggcggccggtgcccataaccaagcctgagggggggctgagccgg
aagccacccctgcagcccaagcccctggtggtgacagctgtgcccatgccccccagtgct
ccccctggccaggctctgctgctgcagcctctgccccatggtcagccccccaccattgca
gtgccggcaccgcctgtcgtgctctcatcgtctgagctgctgcacctgcgggtgtcgggg
ctgctccaagtgaaggcagcagggcctgaggggcccccagggaagccccccaagcccgag
gccaagaccattgtcccggccccagggcaggtggggtcctgtgcccaggagattgatatg
aaggtgctgaagcggcaacagcgcatgatcaagaaccgggagtcagcctgccagtcgcgc
cgcaagaagaaggagtacctgcagggcctggaggcccggctgcatgaggccttggccgag
aacgagcgcctgcggcgggagaatgctgtcctccgccgccgtctggacggtgtgctcagc
gagaacatggagctgaagtttggctcagggaaccggaaagtcgtctgcattatggtcgtg
ctgctcttcattgctttcaactttgggcccataagcatcagtgagcagcgcccaggagac
ctggagccgccgggggaggccgtggagccaggacccagccgccggcacctgctggaggtg
ggccaggaggtcccagtggagcccacgctggcaccacagcctgacctgccccctcctggc
ctagcccaggcccccttcaggaacctgacaggtcccttgtcggggatgaaggacctgatg
ctgcgggacctggacaagttctttctggcctctgactgccgccagttcaaccgcacggag
tcgctcaggctggctgatgagcttagtggctgggtcaggcgccaccagatcaaccggagg
aaacccctgcaggcccgtgagaccccgggccgccagccatcgcctgcccgcccagagccc
agttcatctcgctacgtcccagccagtgcccccaggcaccccgagagggcggcactgagc
cagctgcaggtgtaccagcgtcctgggcgggggcagtatgacttcctggatgccattgac
cggcgtgaggacaccttctatgttgtctccttccgccgggaccaccttctcctcccagct
atcagccacaacaagacctcgcggcccaagatgtcactgctcatgcctgccatggccctc
aatgagagtgtataccgtgcagggcgggactacgaggtcatgatgcagattgactgcgag
gtcatggacacacgcgtcatccacatcaagagctccacggtgccaccttccctgcgccga
ccccaggcccctgccccctcggacaacgggactcaggcgtcctcggtgggtgcccggccc
ccccgtggggctcctcgccctgcccgccggcccccccgccccctctacctcagcggctat
ggtgacggttag

DBGET integrated database retrieval system