KEGG   Alligator sinensis (Chinese alligator): 102383532Help
Entry
102383532         CDS       T02922                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A isoform X1
  KO
K03254  translation initiation factor 3 subunit A
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn03013  RNA transport
Brite
KEGG Orthology (KO) [BR:asn00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102383532 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:asn03012]
    102383532 (EIF3A)
Translation factors [BR:asn03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    102383532 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 102383532
NCBI-ProteinID: XP_025055960
UniProt: A0A3Q0GC00
LinkDB All DBs
Position
Unknown
AA seq 1529 aa AA seqDB search
MPVYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLGQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYHKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRVSLINDMVRFNVVQYVVPEVKELYNWLEVEFHPLKLCTRVTKVLNWVKDQAEK
EPELQLYVPHLQNNTILRLLQQVAQIYQTIDFSRLATLVPFVDAFQLERAIVDAARHCDL
QVRLDHTSRKLSFGSDLNYSTREDAPLGPQLQSMPSEQIRNQLTAMSSALAKALEVIKPP
HLLQEKEEQHQMAVNAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRVH
DMEMWEQQEEERITTLQLEREKALEHKNRLSRMLEDRDLFVDRLKTARRSIYEEKLKQFQ
DRLAEERHTRLEERKKQRKEERRIAYYREKEEEEERLREEQMLKEREEKERVEREKREQE
QREYQERVRKLEEVERKKRQRELEIEERERRREEERRGLDDPFSRKESSRWADRDGESCW
RRGPPERDWRRGEARDDERPFRRGDEPIRRGGADENEHPPSETTDETGPRREVDEDRGPR
REVDEDRGPRREVDEDRGPRREVDEDRGPRHEVDEDRGPRRGLDEDRGSWRATDEDRGPR
RGLDEDRGPRRGLDEDRGPRRGLDEDRGPRRGLDEDRGPRRGLDEDRGPRRGLDEDRGPR
RGLDEDRGPRRGLDEDRGPRRGLDEDRGPRRGLDEDRGPRRGLDEDRGPRRGLDEDRGRG
LDEDRGNWRAADEDRGPRRGLDEDRGPRRGLDEDRGSWGAADEDRGPRRGLDEDRGPRRG
LDEDRGPRRGLDEDRGPRRGLDEDRGSWRAADEDRGPRRGLDEDRGPRRGLDEDRILRRD
EDRGPWRSSDEDRLSRRDDDRGLWRGGDDDRGPRRGDDSRPGPWRPFGKPGGWREREKAR
EDSWGPPRDSRPSADREWDRDKDRDENERDRDFDRDRDFDRDDRFRRPREEAGWRRGPAE
ETSSWRDASRRDEWDRGGRDLRDRRIDDRDRRGPPLRVEREEPNSWRRGDDRREERGEER
EAVRRPAPASALSPALTPSHAPPAPARAVSPSSAPAPDSAPGPVPPPVSKEGERDGEKEK
AAWKTEKEKESLRRIKNETDEDGWTTVRR
NT seq 4590 nt NT seq  +upstreamnt  +downstreamnt
atgccggtctacttccagcgccccgagaacgccctgaagcgggccaatgaattccttgag
gttggcaagaaacaacctgcccttgatgttctttatgatgttatgaaaagtaaaaaacat
cgaacatggcaaaaaatccacgagccgattatgctgaagtacctggagctctgtgtggac
ctccgcaagagccacctggcaaaggaaggattgtaccagtacaagaatatttgccagcag
gtgaacatcaaatctttggaggatgttgttcgagcctatttgaaattagctgaagagaaa
actgaagctgcaaaggaagaatcccagcagatggtgcttgatattgaagacttggataat
attcagactccagagagtgttctcttaagtgctgtaagtggggaagacactcaagatcgt
actgatagactgcttttgacaccttgggttaaatttctgtgggaatcctacaggcagtgt
ttggaccttcttcgaaacaattctagagtggaacgcctctaccatgatattgcacaacaa
gcttttaagttctgcttgcagtacactcgtaaggccgagttccgtaaactatgcgataac
ctgagaatgcatctagggcagatccaacgccatcataaccaaagtacagcaatcaacctc
aataatccagagagccagtctatgcacctggagacgaggctggtacaactggacagtgct
attagcatggaactatggcaggaagctttcaaggcagtggaggatattcatgggctcttc
tctctgtctaagaaaccacccaaaccccagttaatggcaaactactatcacaaagtttca
actgttttctggaaatctggaaatgctctcttccatgcatccacgcttcatcgactttat
catttatcaagagaaatgagaaagaatctcacgcaagaggagatgcaaaggatgtctacc
cgagtccttctagccacgctgtcaatccctataactcctgagcgaacagatattgctcgt
cttctggatatggacggcattattgttgaaaaacagcgacgtctggcaacactgctgggc
ctccaggccccacctacacgtgtcagtcttattaatgatatggtgaggttcaatgtggtg
cagtatgtagttccagaagtgaaggaactttacaattggcttgaagtagaattccacccc
ctaaagctgtgtacccgtgtaaccaaggtcctgaactgggtgaaagatcaagctgaaaag
gaacctgaactgcagctctatgtcccacatctgcaaaacaacaccattcttcgactcctg
cagcaggtggcccaaatttatcaaaccattgatttttctcgtctggctacccttgttccc
tttgttgatgctttccagctggaacgtgctattgtagatgcagccagacactgtgacttg
caagttcgccttgatcatacctctcgaaaattgagctttggatcagatttgaactactct
actcgagaagatgctccacttggtcctcagctgcaaagcatgccttctgagcaaattaga
aatcagctgactgctatgtcttctgctcttgctaaggctcttgaagttattaaaccccct
cacttgttgcaagagaaggaggagcaacatcagatggctgttaatgcttacttaaaaaat
tcaaggaaagagcatcaacgtatccttgctcgtcgtcaaactatagaagagagaaaggag
cgtctggaaagtctaaacattcagcgtgaaaaagaagagctggagcaacgtgaagctgaa
ctacaaaaagttcgtaaagctgaggaagaaaggctgcgccaggaggcaaaggagagagaa
aaggagcgtattctgcaggagcatgaacaaatcaaaaagaaaactgttcgcgaaaggttg
gaacagatcaagaagactgaactgggagccaaggcattcaaagatattgatattgaagat
cttgaagaattggaccctgacttcattatggctaaacaggttgaacagctggagaaggaa
aagaaagaactccaagaacgtctgaagaatcaggagaagaagatcgactattttgaaaga
gcaaaacgcttagaagaaattcctctaataaagagtgcctatgaagaacaaagggttcat
gatatggaaatgtgggagcagcaggaagaagaaaggatcaccactctgcagttggaacgt
gagaaagcccttgagcataagaacagactatcaaggatgctggaagatagagacttattt
gtagataggctcaagacagcacggcgatcaatttatgaggaaaaattgaaacagttccaa
gacaggttagcagaagaaaggcatactcgtttggaggaacgcaaaaaacaacgcaaagag
gagaggcggattgcctattacagagaaaaagaggaggaagaggagagactgcgagaggag
cagatgcttaaagagcgtgaagagaaggaacgtgttgaacgtgagaaacgtgagcaagaa
cagcgtgaataccaggagcgggtcagaaaactagaagaagtggagaggaaaaaacgtcaa
agagaactggagattgaagagagagagcgtcgcagagaggaggagagaaggggtcttgat
gatccattttcaagaaaggagtcatctcgctgggcagacagagatggtgaaagctgctgg
agaagaggaccaccagaaagggactggcgtcggggagaagcacgagatgatgaaaggccc
ttccgacgcggagatgaaccaattagacgtgggggtgctgatgaaaatgaacatcctccc
tcagaaacaactgatgagacgggccccaggcgtgaagtggatgaggacaggggccccagg
cgtgaagtggatgaggacaggggccccaggcgtgaagtggatgaggacaggggccccagg
cgtgaagtggatgaggacaggggccccaggcatgaagtagatgaggacaggggccccagg
cggggcttggatgaggacagggggagctggcgggctacagatgaggacaggggccccagg
cgtggcctggatgaggacaggggccccaggcgtggcctggatgaggacaggggccccagg
cgtggcctggatgaggacaggggccccaggcgtggcctggatgaggacaggggccccagg
cgtggcctggatgaggacaggggccccaggcgtggcctggatgaggacaggggccccagg
cgtggcctggatgaggacaggggccccaggcgtggcctggatgaggacaggggccccagg
cgtggcctggatgaggacaggggccccaggcgtggcctggatgaggacaggggccccagg
cgtggcctggatgaggacaggggccccaggcgtggcctggatgaggacagggggcgcggc
ctggatgaagacaggggcaattggagggctgcagatgaggacaggggccctaggcgtggc
ctggatgaggacaggggccctaggcgtggcctggatgaggataggggcagttggggggcc
gcagatgaggacaggggccctaggcggggcctggatgaggacaggggccctaggcggggc
ctggatgaggataggggccctaggcggggcctggatgaagacaggggccctaggcggggc
ctggatgaggacaggggcagttggagggctgcagatgaggaccgaggtcccaggcgtggg
ctggatgaggaccgaggtcccaggcgtgggctggacgaggacagaatattgagacgagat
gaagacagagggccctggcgtagttcagatgaggaccgactctcgagacgtgatgacgac
aggggtctatggcgtggaggggatgatgacagaggtcccagacgtggcgatgactcaaga
cctggtccttggagaccatttggtaaaccaggtgggtggagagaacgagaaaaggctcgt
gaagacagttggggacccccaagagactccagaccctcagcagaccgagaatgggataga
gataaagatcgtgatgaaaatgaaagggaccgtgattttgacagagatcgtgactttgat
cgggatgatcgtttccgacgccctagggaagaagctggttggaggcgaggaccagctgag
gaaacttccagctggcgagacgcatctcgccgagatgagtgggacagaggtggtcgtgat
cttagagatcggcgtattgatgacagggacagaagaggacctccactcagagtagaacgg
gaagaacccaactcatggcggcgtggtgatgacaggagagaagagcgtggcgaagaacgt
gaagctgtgcggcgacctgctcctgcttctgctttgtcgcctgctcttactccatctcat
gctcctcctgcccctgcccgtgctgtttctccttcttctgcccctgcccctgactctgcc
cctggccctgtccctccccctgtttccaaggaaggagaaagagatggagagaaagagaag
gctgcctggaaaacagaaaaagagaaagaatcccttcgtcgcattaaaaatgagacagac
gaagatggatggaccactgtacggcgttaa

DBGET integrated database retrieval system