KEGG   Alligator sinensis (Chinese alligator): 102383699
Entry
102383699         CDS       T02922                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
asn  Alligator sinensis (Chinese alligator)
SSDB
Motif
Pfam: Nore1-SARAH RA Ras_bdg_2 DUF5663
Other DBs
NCBI-GeneID: 102383699
NCBI-ProteinID: XP_025060130
UniProt: A0A3Q0GPM7
LinkDB
Position
Unknown
AA seq 270 aa
MPSPSSSHPDCKFMCHYRCRALIRLDCSGPRYQDNSSEANEQTVEKDTNVDEQIDWEKPV
LSQAEIEQKIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPATKKTPTIHDAK
KVARSQAVKRRTSFYLPKDTVKHLHIISRTRASEVIEALLKKFMVVDNPRKFALFERSEK
EDQVYLRKLPDDEQPLRLRLLAGPSEKVLSFVLKENETGEVNWDAFSMPELHNFLRILQR
EEEEHVRQILQKYAHCRQKMQEALATRTPG
NT seq 813 nt   +upstreamnt  +downstreamnt
atgccctctccttcctcttcccacccagattgcaagttcatgtgccattatcgttgccgt
gccctgatccgcctggactgcagcggtcctcgataccaggacaactcatctgaggccaat
gagcagacagtggagaaagacaccaatgtggatgagcagattgactgggagaagccggtt
ctgagccaagctgagattgagcagaagataaaggagtacaacagtcaaatcaacagcaac
ctcttcatgagcctgaacaaagatggctcctacacgggtttcatcaaggtgcagctgaag
ctggtccggccagtctctgtgccagccaccaagaagacacccaccatccatgatgccaag
aaggtggcacgctcccaggcggtgaagcggcgcacatcattctacctgcccaaggacaca
gtcaagcacctgcacatcatctcccgcacgcgggccagtgaggtcattgaggccctgctc
aagaaattcatggtggttgacaatccccgcaagttcgctctattcgagagatctgagaag
gaagaccaagtttacctgcggaagttgcctgatgacgagcagcccctgcgtcttcggctg
ctggctggccccagtgagaaggtcctcagctttgtcctgaaggagaacgagactggggag
gtcaattgggatgccttcagcatgcctgagctgcacaacttcctgcgaatcctgcagcgg
gaggaggaggagcatgtccggcagatcctgcagaagtatgcccactgtcgccagaagatg
caggaagcgctggccactcgcaccccaggctga

DBGET integrated database retrieval system