KEGG   Alligator sinensis (Chinese alligator): 102383946Help
Entry
102383946         CDS       T02922                                 

Gene name
RASSF5
Definition
(RefSeq) LOW QUALITY PROTEIN: ras association domain-containing protein 5
  KO
K08015  Ras association domain-containing protein 5
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:asn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102383946 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA C1_1 PIP49_N
Motif
Other DBs
NCBI-GeneID: 102383946
NCBI-ProteinID: XP_025061281
UniProt: A0A3Q0GND5
LinkDB All DBs
Position
Unknown
AA seq 328 aa AA seqDB search
MRMTEGKAEAAACFGVVTKRIRKIFRHFPKSKSWTEGLQCRRRPSREALLAKDCKYTCHQ
ECRSLIQLDCNQPGEQPQNKASPENTLTQDYSQHVAKPAEEEKHKPPTIQELKQKIDDFN
AKVTNCLLMKLNEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIXXXXXXXXXXDALKEVNM
ADMTDKRTSFYLPLDAVKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKEMQKDGQV
LFQKLSLTEYPLYLRLLAGPDTDVLSFVLKENETGEVEWDAFSIPELQNFLMILDKEEKD
KIQQVQSKYGKFKQKLQQTLKEAGGKPG
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgacagaagggaaagcagaggcagccgcttgctttggagttgtaacaaagaga
atccgcaagatattcaggcacttccccaagtcaaaatcctggaccgagggtctccagtgc
cgtcggaggcccagcagggaggctttgttggctaaagattgcaaatacacctgccatcag
gagtgcaggagcctcatccagctggactgcaaccagcccggagagcaacctcagaacaag
gcctccccagaaaataccctgacgcaagactacagccagcatgtagcaaaaccagccgaa
gaagaaaaacacaagcctcccaccatccaggagctaaagcagaaaattgatgatttcaat
gcaaaggtcacaaactgcttgttgatgaagctgaatgaagatggcacctacacgggcttc
attaaagtgcacttgaaactgcgccggcctgtgaccgtgccagcagggatcaggccgcag
tccatcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngacgctctcaaggaggtgaacatg
gccgacatgacggacaagaggacttcgttttacttgccgctggatgccgtcaagcagctc
cacatcagcagcacgaccacagtcagcgaggtcatccaggggctcctgaagaagttcatg
gtggtcgacaaccctcagaagtttgcacttttcaaggagatgcagaaagacgggcaagtt
ctctttcagaagctatctctaacagagtaccccttgtatctccgcctgctggctggcccc
gacacagatgtgctcagttttgtactgaaggaaaatgaaacgggggaagttgagtgggac
gcattctccattccagaactacagaacttcttaatgatactggacaaagaggaaaaggac
aaaatccagcaagtacagagcaagtatggcaagtttaaacagaaactacagcagaccttg
aaagaagcaggaggaaagcccggataa

DBGET integrated database retrieval system