KEGG   Alligator sinensis (Chinese alligator): 102384629Help
Entry
102384629         CDS       T02922                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2 isoform X2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:asn01002]
    102384629 (TMPRSS2)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102384629 (TMPRSS2)
Peptidases [BR:asn01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102384629 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 Ldl_recept_a SRCR Trypsin_2
Motif
Other DBs
NCBI-GeneID: 102384629
NCBI-ProteinID: XP_006033649
UniProt: A0A1U7S9G8
LinkDB All DBs
Position
Unknown
AA seq 489 aa AA seqDB search
MASNSGLPPYYENHGYEPERSYNSRHVIDTSGYPQYIPTSHPASVPHYVPSVPPQHSATV
VVQPKPSSEKLCTSGVKKTLCIVLAVAVILTGAVVAALLIWYFVQDPCFDSSIECGSSGK
CVPLSQWCDGRFDCPNGEDENRCVRLYGPNFILEVYSSENKSWYPVCADDWNDDYGKTAC
KDMGYNVNTYYSSGRIAIEKGAKSFLRLNTSAGNIDLYKRLYNSDSCALGTVVSLRCIKC
GYSRNNLMPKGRIVGGSAASLGQWPWQVSLHIQNTHVCGGSLITPEWVVTAAHCVEGQLA
DPSYWKVFAGILTQDEMRLRSGHRVQKIIPHPNYNTETKDNDVALMKLQTSVSFTNFVAP
ICLPNPGMMFQPNQSCWISGWGALQQGGKTSNFLNAVMVPLIEPSRCNAGLVYNGLILPT
MICAGYLEGLIDSCQGDSGGPLVTAKDSVWWLVGDTSWGTGCATRNRPGVYGNMTMFTAW
IYRNMQANR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaaactcagggctaccaccatactatgaaaatcacggctatgagccagaaagg
tcctataattctaggcacgttatagacactagcggctatccacagtacattcctacaagc
catcctgcatcagtgccacattatgttccaagtgttcctcctcaacattcagctacagtg
gtagtacagccaaagccttcgtctgagaaactgtgcacatcaggtgttaagaaaacctta
tgcattgtcttagctgttgcagtaatcctcacaggtgcagtagttgcagcactccttatc
tggtattttgtgcaggatccgtgttttgattcttcaatagaatgtgggtcttcaggaaaa
tgtgtgccattatcccagtggtgtgacggacgcttcgactgtcctaatggtgaagatgaa
aaccgatgtgttaggctctatggacccaatttcattctggaggtctactcatcagagaac
aaatcctggtatcctgtatgcgcagatgactggaatgatgattatggaaagacagcatgt
aaagacatggggtataatgtaaatacttattactctagtgggagaatagcaattgagaaa
ggagctaaaagctttctgagactgaacacaagtgctgggaatatagacttgtacaagaga
ttgtataacagtgattcctgtgcattgggaacagtggtttctctgcgctgcataaagtgt
ggctattccagaaacaacctgatgcctaaaggcagaattgtgggtggaagtgccgcatca
cttgggcagtggccatggcaggtcagccttcatatccagaacactcatgtatgcggaggc
tccctcatcacccccgaatgggtagtgacagcagcacactgtgtggaaggacagcttgca
gatccatcttactggaaagtttttgctgggattctaacacaggatgaaatgcgtctgaga
agcggacacagagtccagaaaataattccacatccaaattacaatacagagactaaagac
aatgatgttgcccttatgaagttacagacatcagtgagttttacaaattttgtagcacca
atttgtctgccaaaccctggaatgatgttccagcctaatcagtcatgctggatatctgga
tggggagccctacaacaaggaggtaaaacctcaaattttttgaatgctgtgatggtgcct
ttgatagagccttccagatgtaatgctgggttagtctataatggcctcattttgcctact
atgatatgtgctggatatctagaaggactaattgattcctgtcagggtgacagtggaggc
cctttagtaacagcgaaggactctgtgtggtggctagttggtgacacaagctggggaact
ggctgtgccactcgcaatagacctggagtttatggaaatatgaccatgtttacggcttgg
atttacagaaacatgcaggcaaacagatga

DBGET integrated database retrieval system