KEGG   Alligator sinensis (Chinese alligator): 102385752Help
Entry
102385752         CDS       T02922                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00040  Pentose and glucuronate interconversions
asn00051  Fructose and mannose metabolism
asn01100  Metabolic pathways
Module
asn_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102385752 (SORD)
   00051 Fructose and mannose metabolism
    102385752 (SORD)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     102385752 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C DUF281 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 102385752
NCBI-ProteinID: XP_025055683
UniProt: A0A3Q0GBY4
LinkDB All DBs
Position
Unknown
AA seq 384 aa AA seqDB search
MRCERARDRRAAPQRPRETGQDGAACGLAQETAVVLSPVVTGGFVPPDCENRPIPEPGPN
EVLLKMHSVGICGSDVHYWQHGRIGDFVVKKPMVLGHEASGTVLKVGSSVTHLKPGDRVA
IEPGAPREVDEFCKIGRYNLSPTIFFCATPPDDGNLCRYYKHNASFCYKLPDNITFEEGA
LIEPLSVGIHACQRAGVTLGSKVFICGAGPIGLVTLLIAKAMGAAQVIITDLTASRLEKA
KEIGADFTLVVKKETPQELASKVQGLLGCMPEITVECTGAQDCIQAGIYATHSGGTLVLV
GMGQEMVTIPIVNAAVREVDIRGIFRYCNTWPMAISLLASKRVNVKPLVTHRFPLEQALE
AFETTRKGVGVKVMLKCDPSDQNP
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcgatgtgagcgggccagggacaggagagcggccccgcagcgcccacgggagactggg
caagacggagccgcgtgcggcctggcccaggaaacggccgtcgtgttgtcgcccgttgtg
acagggggctttgtgccgcccgactgcgagaatcgcccaatcccagaaccaggtcccaat
gaggtgctgctgaagatgcattctgttgggatctgcggatccgatgtccactactggcag
catggccgaattggggactttgttgtgaagaagccaatggtactgggacatgaggcatct
ggaactgtccttaaagtgggttcctcagtaacccatctgaagccaggcgaccgagtagcc
attgagcctggtgcccctcgagaagtggatgaattctgcaagattggacgctataacctg
tctcccacgatcttcttctgtgcgacaccacctgacgatgggaacttgtgcagatattac
aagcacaatgccagcttctgctacaagcttccagataacatcacctttgaagaaggggcc
cttattgaacccctttctgtgggaatccatgcctgtcaaagggccggagtcactctggga
agcaaagtcttcatctgtggggcaggacccattgggctggttaccttgcttattgctaag
gcaatgggtgctgcacaggtgataattactgatttaactgcctctcgcctggaaaaagcc
aaggagattggggcagatttcactcttgtggtgaaaaaagagacaccacaggagctggcc
tccaaggtacaaggcttgcttggctgtatgccggagataactgtggagtgcactggggca
caggactgcattcaggctggcatttatgccactcattctggagggacccttgtcctagta
gggatggggcaggaaatggtcactatccctattgtgaatgctgctgtgcgagaggtggac
atcaggggaatatttcgctactgcaacacgtggcccatggcaatttctttgcttgcatcc
aagagagtgaatgttaaacccttggttacacatcgcttccctttggaacaggctctagag
gcctttgagaccaccaggaagggtgtgggagtgaaagtcatgctgaagtgtgaccccagt
gatcagaatccttga

DBGET integrated database retrieval system