KEGG   Alligator sinensis (Chinese alligator): 102385854
Entry
102385854         CDS       T02922                                 

Definition
(RefSeq) gamma-interferon-inducible protein 16-like
  KO
K12966  absent in melanoma 2
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04621  NOD-like receptor signaling pathway
asn04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102385854
   04623 Cytosolic DNA-sensing pathway
    102385854
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon
Other DBs
NCBI-GeneID: 102385854
NCBI-ProteinID: XP_006029691
UniProt: A0A1U7SFN3
LinkDB
Position
Unknown
AA seq 325 aa
MEAGDEHCFDILLCGLGDLEEYDFKKFKGKLSDAERSDKIPRCKLQNADVPTLASLMIQH
FGRKLAVTTAKRILRDLHLKEALNIMIEKEKAKGLSKAKGKKPLEKKLKSHPAKNTGQNT
GSCKNQRTKNETMIKEPFVAKVIKVTKPFKYSNSDGKRNQVFHAVVLNASAKTRIRIFDV
EKHPLFKKNKTIEISNYYKKEGYLQVVKHSICEIKEVELVIPKKMHKDAVRRTRIEDIQE
MPEKSYVDGTFTVKKKWPEKSYTRFTVTDDTGELEVMAFGEVGNVKAAEGDRLQLTCFKT
NMFNSKLQLKSEMHSRIQVIKQRKK
NT seq 978 nt   +upstreamnt  +downstreamnt
atggaagcaggagatgagcactgttttgatatcttgctctgtggcctgggcgacttggaa
gagtacgattttaaaaaattcaaaggaaaattgtctgatgcggagcgttccgataaaatt
ccccggtgcaaactgcaaaatgccgatgtcccgacattagccagtctcatgattcagcac
ttcggcaggaagctagcagtgacaacagcaaaacgcatcctaagagacctccatttaaaa
gaagctcttaacataatgattgagaaagagaaagctaagggattatcaaaggcaaaagga
aaaaagcctctggagaagaaactgaagagccatccagcaaagaacacgggacaaaacact
ggatcctgcaagaatcaacgtacaaaaaatgaaacgatgatcaaagagccctttgtggcc
aaagtaataaaagtgacaaaaccattcaagtacagcaattctgatggtaaaaggaaccag
gtgtttcatgctgttgtgctaaatgcatctgcaaaaacaaggattagaatttttgatgtg
gaaaaacacccgctttttaaaaaaaataaaacaattgaaatatcaaattattataaaaaa
gaggggtatttgcaagtagtgaaacactcgatctgtgagataaaagaagtggaacttgtc
attccaaagaaaatgcataaagatgccgtgagaagaaccaggattgaagacatacaggag
atgccagaaaagtcctatgtggatggaacttttacagttaagaagaaatggccggaaaaa
agttacacccgttttacagtgacggacgacacaggagaactagaagtcatggcgtttggt
gaagtgggtaatgtgaaagcagcagagggcgacagactccagctcacctgtttcaaaaca
aacatgtttaactccaaattacagctcaaatcggaaatgcacagtcgaatccaggttata
aagcaaagaaagaaatga

DBGET integrated database retrieval system