KEGG   Alligator sinensis (Chinese alligator): 102387292
Entry
102387292         CDS       T02922                                 

Gene name
WDR62
Definition
(RefSeq) WD repeat-containing protein 62 isoform X1
  KO
K21762  WD repeat-containing protein 62
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:asn03036]
    102387292 (WDR62)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102387292 (WDR62)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 DUF5046
Other DBs
NCBI-GeneID: 102387292
NCBI-ProteinID: XP_025070123
UniProt: A0A3Q0HI12
LinkDB
Position
Unknown
AA seq 1056 aa
MAISFSEDSYFVTVGHRHVKFWFLDAPREVKIKETVPLVGRSGLLGELHNNIFCGVACGQ
GKMLGNTFCVSYSGLLCQFNEKRMLEKWIDLKVSQANCICVSEKFIFCGCANGTVRIFHS
HNMHYLTDLPKPHYLGADVAKEPEPRTTLSPTLPVRRPDSVCPDAIALAFDPRNQWLSCV
YKDHSVYVWDVKDTSKVGKVWSDLFHSSFVWNIEVYPELEDHQSCLPPGSFLTCSSDNTI
RIWNLENGTRSDFQKNIYSDTLLKVIYVDNNTQHLQDPTNVPDRGENAGYLDVKSGVRVM
QVSPDGQHLASGDRGGNLRIHELQFMHEVVKVEAHDSEVLCLEYSKPETGMALLASASRD
RLIHVLNVDKYYRLEQTLDDHSSAITAVKFAGNGEVQLISCGADKSIYFRSAQKVADGIN
FVRTHHVAEKNTLYDMDVDITEKYVAVACQDRNVRVYHTASGKQKCCYKGSQSDDGSLLK
VQLDPLGTFLATSCSDKSISIIDFQSGDCVAKMYGHSEIVTGMKFTYDCKHLITVSGDSC
VFIWLLGPEITNSMNQHLIELDETQRQKKARGLNCFNQIRRKTYVAVPSGMRSPPNADDE
TDEQEEGSALQTPAKDDSDTAPVFILTNGKLPMWAKRLLGETDNLDSMTYLPRVDYQPQG
RWAERAEKDPIKTLLDADYFTPIKNSFVGDTELEPKNLDSLLLQTENSPSNIIDNFKPSD
IFLEDDANQEVESLESTENSTCSMQAGDSFLEGDRTSLKELPLQPIYQKEGSKDKASSVV
SLDSEASTFDLQQEESAVSDGDAEVEVETMDVDENSQRNVSLPQTPEQEKYLKHHFETLT
DPPAEEKFDGCLKDLKPPEERDEEKDFFLNPRLSISARFLSRCQKNRFAAAFLPRPRPPF
QSSTEAQDHGNEKNKLPGESKKPEKPPEEKPPEMIENPKSKTYNTSETQRLIRSLHAKFQ
ETLQLYDKVAYSKESTEDEQLQIQPLLASTFCWMKTELDSRRVKTHVDVATATESPFPPL
KGPHDNEMLSLLTYYSESLVRMVQKKLDDSNKPEVV
NT seq 3171 nt   +upstreamnt  +downstreamnt
atggcaatatccttttcggaggacagctacttcgtcaccgttggccaccgccatgttaaa
ttctggtttttggacgcgccaagagaagtgaagatcaaggagaccgtgcctctggttggt
cgctctggccttctgggtgaacttcacaataacatcttttgcggcgtggcctgtggccag
gggaagatgctgggcaatactttttgtgtttcatactcagggctcctttgtcaattcaat
gagaagcgcatgttggaaaaatggattgatttgaaggtttcgcaagcaaactgcatctgc
gttagtgagaagtttatcttttgtggctgtgccaatggcaccgtgaggatctttcattcc
cataacatgcactatctcaccgacctacccaagccgcattacttgggtgctgatgtagcc
aaagaaccagaaccaagaacaactctttctccaactcttcctgtaagacggccggattct
gtctgtccagatgccatcgccttggcattcgacccacgcaatcagtggctgtcttgcgta
tacaaagaccacagcgtatatgtctgggatgtcaaagacaccagcaaagtggggaaagtg
tggtcggacctcttccacagttcctttgtgtggaacatcgaggtttaccccgagttggag
gatcaccaatcctgtttgcctccgggatcttttctgacgtgctcatcggataacaccatt
cgaatttggaacttggaaaacggcacaagatctgacttccagaagaacatctacagtgat
accttgctgaaagtgatctatgtggacaacaacactcagcatctgcaagacccaaccaat
gtgcccgaccggggcgaaaatgcaggctaccttgatgtgaaatcgggtgttcgtgtgatg
caggtcagccccgacggccagcacttggcttcaggtgaccgaggaggcaacttgaggata
catgagctacaatttatgcatgaagtggttaaagtagaagcccatgattcggaagttctc
tgcttggagtattccaaaccagaaactggaatggcgctcctggcttccgccagcagagat
cggctgattcacgtgctaaatgtagataaatattacagactggagcaaactctagatgat
cactcatcagccataacagctgtaaaatttgccggtaacggagaagtacagctaataagc
tgtggggctgacaaaagcatttatttccgcagtgcacaaaaagtggcggatgggattaat
tttgtcagaactcatcacgttgccgagaaaaacaccctgtatgacatggatgtcgatata
accgagaaatatgttgctgtagcctgtcaggatagaaacgtcagggtgtaccatactgca
agtggaaagcagaagtgctgttacaaaggttctcaaagcgatgatgggtcgctcctgaag
gtgcagctggatcccttgggaactttcttagcaacaagctgctctgataagagtatctcg
attattgatttccagtccggtgactgtgtggccaagatgtatggacattcagaaattgtc
actgggatgaagttcacttatgattgcaaacacttgatcaccgtctcaggagacagctgc
gtgtttatttggctacttggcccggagattacaaactctatgaaccagcatttgatcgaa
cttgatgagacgcagcggcagaaaaaagcacggggtctaaactgttttaaccaaatcagg
cggaagacgtacgtggccgtacccagtggaatgaggtctcccccgaatgctgacgatgaa
accgatgagcaggaagaagggtccgctctgcagacccctgccaaagacgactcggataca
gctcctgttttcatactgaccaatggcaaactgccaatgtgggcaaagagactgctggga
gagaccgataacttggacagcatgacatacctgccccgggtggattaccagccgcaaggc
cgatgggctgaacgggccgagaaagacccgattaaaaccctcctggatgcagattacttc
acccccataaaaaacagcttcgtgggtgacaccgagctggaaccgaagaatctggactcg
ttgctcctgcagacagagaattccccaagcaacatcattgacaacttcaaaccctcggat
atctttctggaggatgatgccaatcaggaggtcgaatctctcgaaagtactgaaaacagc
acatgctccatgcaggctggggacagcttcttggagggtgaccggacaagtttaaaagag
ttgcctcttcagcccatttatcagaaggagggcagcaaagataaagcttcctccgtagtt
tcattggattctgaagcctctacttttgatctgcagcaagaagagtctgcggtctcagac
ggggacgcggaggtggaagtagaaacaatggacgtggatgagaattcccaacgaaatgtc
tctctgccccaaacccccgaacaagaaaagtacctcaagcatcattttgagacattgacg
gaccccccagcagaagaaaaatttgatggctgcttgaaagatctgaagccgcctgaagaa
agggatgaggagaaggacttcttcttgaatccacgcttgagcatttctgcaagatttctt
tcacgctgccagaaaaatagatttgccgctgcctttcttccaaggccacgcccgccattt
cagagtagcactgaagcacaagaccacggcaacgaaaagaataaattacctggcgagtcc
aagaaaccagagaagccaccagaagaaaagcccccagagatgatagaaaacccaaagtca
aagacgtacaacacatcggaaacacagcgcctcatcagaagcttgcatgcaaaattccag
gagacactgcagctttatgacaaggtggcttattccaaagaatccactgaggacgaacag
ctccagatccagcccctcctcgccagcactttctgctggatgaaaaccgaactggattcc
cgaagggtcaaaacccatgtcgatgttgccacggctacagagagccccttccctcctctc
aaaggtccccatgacaatgagatgctttctctcctgacatattattcggagtcgttggtg
agaatggtccagaaaaaactcgacgacagtaacaaaccagaggtggtttga

DBGET integrated database retrieval system