KEGG   Alligator sinensis (Chinese alligator): 102387365Help
Entry
102387365         CDS       T02922                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102387365 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 102387365
NCBI-ProteinID: XP_006030543
UniProt: A0A1U7S7G7
LinkDB All DBs
Position
Un
AA seq 688 aa AA seqDB search
MAEDLVLETCDLQHESNGVTHRTEEMGSQRLVVRRGQPFTIMLHFAGRGYEDGVDTLALN
VQTGPCPTETWGTRSHFPVSSRLQASAWSAAVEQQDGTALSLSLCSPPDARIGLYTLTME
ASTGYQGTSFRLGDFILLFNPWCPEDTVYLEDEDQRTEYVLTQQGIIYQGSNDFIVSAPW
NFGQFEDNMVETCLLLLDTNPKFFRDQNRDCSRRNCPVYIGRVVSAMVNCNDDQGVLAGR
WDNQYSDGVSPMSWIGSVEILRRWSKFGCQPVRYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDTNQNLVIDRYLDERGSLQQGSKDMIWNFHCWVESWMARPDLSAGYDGWQALDPT
PQEKSEGVYCCGPSPVKAIKEGDLVLNYDIPFVFTEVNADLIYWILQSDGSRKKTVHPSI
VGKSISTKGVGRDSREDITHHYKYPEGSDKEREVFAKAKRQKRPVPQEETGMTMRIKVPQ
GANNGCDFDVVAAIHNDTDAERQCRLMFCARVASYNGNVGPECGMKDLLNVTLPPRGDKV
VPLRVLYEKYGHCLTQDNVVKVVALLVEYQTREHIVAMRDIYVKNPDIKIRILGEPKQKR
KLVAEITLTNPLATPLNGCSFTVEGAGLTEGQKIQELDCPVEPGQEAKARVDLMPRQAGL
RKLVVDFESDKLKGVKGFRNVIIAPLPK
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagatctggtgctggaaacatgcgacctgcagcacgagagcaacggggtgacg
cacaggacggaggagatgggtagccagcggctcgtggtgaggaggggccagcccttcacc
atcatgctgcacttcgcggggcgggggtatgaggacggcgtggacacacttgccctcaac
gtgcaaacaggaccgtgccccacggagacctggggaacccggagccacttccccgtctcc
agccgcctgcaggcgtcggcgtggagcgcggcggtggagcagcaggacggcacggctctc
tccttgtccctctgctccccgcccgacgctcgcatcggcctctacaccctgaccatggag
gcctccaccggctaccaaggcaccagcttccggctgggcgacttcatcctgctcttcaac
ccgtggtgtccagaggacaccgtctatctggaggatgaagaccagcgcaccgagtacgtg
ctgacgcagcagggcatcatctaccagggctcaaacgacttcattgtctccgcaccctgg
aacttcgggcagttcgaggacaacatggtggaaacgtgcctcctgctgctggacacgaac
cccaagttcttccgggaccagaaccgggactgctcccgccgcaactgccccgtctacatc
ggcagggtcgtaagcgccatggtgaactgcaatgatgaccagggggtgctggcagggcgc
tgggacaaccagtacagcgacggggtgagccccatgtcctggataggcagcgtggagatc
ctgcggagatggagcaagttcggctgccagcccgtcagatacggccagtgctgggtcttc
gcggcggtggcctgtacagtcctgaggtgcctggggattcccacacgcgtggtgaccaac
tacaactctgcccacgacaccaaccagaacctggtcatcgaccgctacctggacgaaaga
ggcagcctgcagcaaggatccaaagacatgatatggaacttccactgctgggtggagtcg
tggatggcccgtcccgacctctccgctggctacgacgggtggcaggcgctggaccccact
ccgcaggagaagagcgaaggggtttactgctgcggcccctcgcccgtcaaagccatcaag
gaaggcgacttggtcctgaactacgacatcccattcgtcttcacggaggtcaacgcggac
ctgatctactggatcctgcagagcgatggctcccggaagaagaccgtccacccctccatc
gtggggaagagcatcagcaccaagggcgtgggccgagacagcagggaggacatcacccac
cactacaagtaccccgaaggctccgacaaggaacgggaagtgttcgccaaagccaaacgc
cagaagaggccggtgccccaggaggagacgggcatgaccatgaggatcaaggtgccgcag
ggtgccaacaacggctgcgactttgacgttgtcgccgccatccacaacgacaccgatgcc
gagcggcagtgccgcctcatgttctgcgcccgcgtcgccagctacaacgggaacgtgggt
cccgagtgcggcatgaaggatctgctcaacgtcacgctgccgccccgtggagacaaagtg
gtgccgctgcgtgtcctgtatgagaagtacggccactgcctgacccaggacaacgtggtc
aaagtggtggcactgctggtcgagtaccagacccgggagcacatcgtggccatgcgagac
atctatgtcaagaacccggacatcaagatcaggatactgggggagcccaagcagaagcgg
aagctggtggccgagatcacgctgaccaacccgctggcgacaccgctcaacggctgctcg
ttcaccgtggagggcgccggcctcaccgagggccagaagatccaggagctcgactgcccc
gtggagcccgggcaggaggcgaaggcgcgggtggacctgatgccccgccaggccggcctg
cgcaagctggtggtggatttcgagagcgacaagctgaagggggtgaagggtttccgcaac
gtcatcatcgcccccctgcccaagtga

DBGET integrated database retrieval system