KEGG   Alligator sinensis (Chinese alligator): 102388295Help
Entry
102388295         CDS       T02922                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102388295
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102388295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 102388295
NCBI-ProteinID: XP_006035830
UniProt: A0A1U8DLS0
LinkDB All DBs
Position
Unknown
AA seq 697 aa AA seqDB search
MEALTPTHISWQPSANTSAHRTNRYASKQLVIRRGQSFTITLYFNRPQQPGDSLAFISET
GPSPSEGSRTRAVFNLSSAGASGWSASQGPSESNYTNFTLCSPANAAIGRYNLSLQITCG
NQVSSRFLGQFVLLFNPWCPDDEVHMADEGERQEYTLNENGIIFVGNAKYIQARGWYYGQ
FQDRILNICLTMLDLSLYYRQNPAADVARRGDPKYVGRVLSSMINGNDNDNGVLLGNWQG
NFTEYENPSRWEGSVVILHKWLQDNYRPVQYGQCWVFAGVMCTALRCLGIPNRLISNFNS
AHDSDRNLSVDKYYDPYGRSLPIGKDSSWDYHVWNEGWFVRTDLGPSYNGWQVLDSTPQE
PSKGIFQCGPASVVAVKQGDVDLSYDTLFVFSEVNADSNRWIVYGDGTKKRVYCDTEVFG
RSISTKAVGSNARVDVTNNYKYPEGSPEERQVYKKAWNKIFGSNTTERRPEVLNERSTDA
ARNPGIAGRFKLVEPPVLGHDISLILVLNNLSSEHKSVKVNMSASSILYTRRTVAEILQE
TASVELGANAEKHILLKFPYSRYGKHLTDDKRILVTGLCEVMNMPGVKFLVEKTIMLENP
KIIIKVPSQIVVNRAVNLEIWYTNPLPEPVENCVLLATLMNQQVKINVAGLAPKEQSMIY
YEFTPRQTGNLQLQIDFSCNKFSHVKGFVTIYVAPGH
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggaagctctaacaccaacgcacatcagctggcaaccttcagccaacaccagtgcccac
cgcacaaatagatatgcctccaaacaactggtcataagaagaggacagtccttcaccatc
accttatacttcaacaggccacagcagcctggggactccctagcattcatcagcgaaact
ggaccgtccccttcagaagggagtcgtaccagggccgtctttaacctctcttcagcggga
gccagtggctggagtgcaagccaaggacccagcgaatccaactacacaaactttacgctg
tgcagtccagccaatgctgccattggccgttacaacctcagcctccagatcacctgtggg
aaccaggtctcctccaggttcctgggacagtttgtgctgctcttcaacccatggtgccca
gatgatgaagtccacatggctgatgaaggtgagagacaggaatatactctgaatgaaaat
ggaatcatctttgtgggaaatgcaaagtacattcaagcaagaggatggtactatgggcag
tttcaagatcgcattctaaacatctgccttaccatgctggatctgagcctctactaccgt
cagaacccagccgccgacgtagcccgcagaggagaccccaaatacgtgggtcgggtgctc
agttctatgatcaatgggaatgacaatgataacggggtgctgctggggaactggcaggga
aatttcactgaatatgagaatccatccagatgggaaggcagcgtagtcatcctccataaa
tggcttcaagacaattatcgccctgtgcagtatggccagtgctgggtttttgcaggcgtg
atgtgtacagccctgcggtgcctggggatccctaaccgcctcatcagcaacttcaattct
gcccacgattcggacagaaacctgagcgtggataaatactacgacccttatgggaggagt
ctcccgatcggcaaagactcttcgtgggattaccatgtctggaacgaaggctggttcgtt
cggacagacctgggaccatcatacaatggatggcaggtcctagattcgactccgcaagag
ccaagcaaagggatatttcagtgcggtcctgcctctgttgtagctgtcaaacaaggcgat
gtagacttgagctatgacaccttatttgtgttttcggaggtgaatgctgatagcaaccgg
tggattgtctacggtgatggaactaagaaacgagtttattgtgatactgaggtatttggc
aggtctattagcaccaaggctgtgggcagcaatgcccgtgtggatgtcactaacaactac
aaatacccggaaggctctcctgaggaaagacaagtgtataaaaaggcatggaacaagata
tttggatcaaacaccacagagagacgcccagaggttcttaatgaaagatccacagatgca
gctaggaatcctggcatcgctgggagattcaagctggttgaacccccagtgcttggacac
gacatcagcctaattttagttctcaacaacttgtcctccgaacacaagtctgttaaggtg
aacatgagtgcatcaagtatcctgtacaccaggagaacagtggcagagatcctgcaggaa
accgcctctgttgaactcggcgctaacgcagaaaagcatattctactaaagttcccttac
tcccggtatggaaagcacctgactgatgacaagaggatcctggtcaccgggttgtgtgaa
gtcatgaacatgccaggggtgaagtttctggtggagaagacaatcatgttagagaatccc
aaaatcattatcaaggttccttcccagattgtggtgaacagagcagttaacctggagatc
tggtataccaaccctctcccggagcctgtggagaactgtgtgctgctggcaacgctgatg
aatcagcaggtcaagataaatgtggcaggactagcgccgaaggagcaatcaatgatttat
tatgaattcacaccccgccagaccggtaacttgcagctgcagatagacttctcttgtaac
aagttctcacatgttaaggggtttgtgacaatttatgtggcacctggtcactaa

DBGET integrated database retrieval system