KEGG   Alligator sinensis (Chinese alligator): 102388442
Entry
102388442         CDS       T02922                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102388442 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:asn03000]
    102388442 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:asn03310]
    102388442 (NR3C1)
Transcription factors [BR:asn03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    102388442 (NR3C1)
Nuclear receptors [BR:asn03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   102388442 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 102388442
NCBI-ProteinID: XP_025059814
UniProt: A0A3Q0GJE3
LinkDB
Position
Unknown
AA seq 807 aa
MSGLCLVFKSICSAASLGEAEPANVEGMDPKESLNSSEREEAGKIVRFNDKGGIVMDFHP
TFRGGATVKASASTSPLPASTSPLPASSQSDSKQQPVLGDFSKGLVSNVPQPDLSKAVSL
SMGLYMGETDSKVMGNDIGFPQQGQIGISSGETDFRLLEESIASLNKSSGLAEGTKGTVS
SGLSLKQDFPVMTNCNVPLEPGTLMQGQIGSSGGNMKLFSEDQSTLDILQDLELPPISPG
KEPNGSPWRLDPLLDEGGLLSPLAADEAFLHEGNSGEDCKPLILPDTKPKINERGDLLSS
PPVQMPQVKTEKEDFIELCTPGIKQEKTGPVYCQANFPGSSVLGTKVSAISVHGVSTSGG
QIYHYDLNTASRSQQQDQKPVFNVIPSLTAGTENWNRCQGSGDDPLSPMGNLNFSGRSSF
SNGYSSPGMRSDVSSSPSTTSATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVE
GQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQSNVSSVRD
TPESPGNKSIVPASLPQLTPTLVSLLEVIEPEVLYSGYDSTLPDSSWRILSTLNMLGGRQ
VVAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMSFALGWRSYKQSNGNLLCFAPDLIIN
EQRMSLPCMYEQCKNMLMVAGELSRLQVSYEEYLCMKTLLLLSTIPKEGLKSQALFEEIR
MTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNFCFQTFLDKSMSIEFP
EMLAEIISNQIPKYSNGNIKKLLFHQK
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgtcaggcttgtgtctggtttttaaatccatctgctctgctgcctcccttggagaagct
gaaccagccaatgttgaaggaatggatcccaaagaatcgctgaactcctcagagagagag
gaagcagggaaaattgtgcgcttcaatgacaaaggagggattgtgatggattttcatcca
acctttaggggtggagctaccgtcaaggcttctgcgtctacatctcccctgcctgcgtct
acatctcccctgcctgcgtcttctcagtcagactccaaacagcaacctgttttgggtgac
ttttcaaaaggattagtaagtaatgtgcctcagccagatctttccaaggcagtgtcgctc
tcaatgggactgtacatgggtgagacagattcaaaagtgatgggaaatgacattggattt
ccgcagcagggccaaatcggcatctcttctggagaaacagacttcaggctcctggaagaa
agcattgcaagcttgaacaagtcctctggtctggcagagggcactaaggggacagtgtct
tctgggttgtcactcaagcaggacttcccagtcatgactaactgcaatgtccctttagag
ccaggaacattaatgcagggccagattggctctagtggtggcaacatgaagttgttctct
gaggaccaaagcaccctggatattctgcaggatttagaattgccaccaatctcgccgggt
aaagagccaaatggaagcccgtggagacttgacccattactagatgaaggtggcttgctt
tcccctctagctgcagatgaggcatttctccacgaaggaaattcaggtgaagactgcaag
ccactcatcttaccagacactaagcctaaaattaatgagcgtggagatctcttgtccagt
cccccagtgcagatgcctcaagtgaagacggagaaggaagacttcattgaactctgtacc
ccaggcataaagcaagagaaaacaggcccagtttattgtcaagctaattttcctgggtct
agtgtactgggtactaaagtgtctgccatttctgtccatggtgtcagtacctctggagga
cagatatatcactatgacctgaatactgcctctcgctcacagcagcaggatcagaaacca
gtttttaatgtcattccatctcttactgccggtacagaaaattggaataggtgccaggga
tctggggatgaccctctatctcctatgggaaatttgaacttttctggcagatcttctttc
tctaatggctattcaagccctggtatgagatctgatgtaagctcttctccgtccaccacc
tcagcaactacaggaccgcctcccaagctgtgtcttgtttgctctgatgaggcttctggg
tgtcattatggtgttctaacttgtggcagctgcaaagtgttcttcaaaagagctgtagaa
ggacaacacaattacctgtgtgctggaagaaatgattgtatcattgacaaaatccggagg
aaaaactgtcctgcatgccgctaccggaaatgtctgcaagctggcatgaacttagaagct
cgaaaaacaaagaagaagataaaaggaattcagcagtccaacgtgtcatcagtgagagat
actcctgaaagtcctggaaacaagtctatagttcctgcatcactgccacagctaacccct
accctggtttccctgctggaagtcattgaaccggaagttttgtattcaggctatgacagt
acgctacctgactcaagttggcgtatattgtcaactctcaacatgttaggaggacgacaa
gtggtagctgcagtaaagtgggcaaaggcaataccaggtttccgaaatttacatctggat
gaccaaatgacccttttgcagtactcctggatgttcctgatgtcttttgctttaggatgg
agatcatacaaacagtcaaatggaaatctgctgtgttttgcaccagatctgattattaat
gaacagagaatgagcctgccatgtatgtatgaacagtgcaaaaatatgcttatggttgct
ggggagctatcacggcttcaagtttcatatgaagaatatctctgcatgaaaaccttgctg
cttctttctacaattcctaaggagggcctgaaaagtcaagctttgtttgaagaaattcgt
atgacatacattaaagagctggggaaagccatagtgaagagagaagggaactcgagccag
aactggcagcggttttatcaactgactaagcttttggattccatgcatgaagtggttgaa
aatcttctgaacttttgcttccaaacgtttttggataaatccatgagtattgaattcccc
gagatgttggccgaaatcatcagcaatcagataccaaaatattcaaatggaaatatcaag
aagctcttatttcatcaaaagtga

DBGET integrated database retrieval system