KEGG   Alligator sinensis (Chinese alligator): 102388581Help
Entry
102388581         CDS       T02922                                 

Gene name
MRE11
Definition
(RefSeq) double-strand break repair protein MRE11
  KO
K10865  double-strand break repair protein MRE11
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn03440  Homologous recombination
asn03450  Non-homologous end-joining
asn04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:asn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102388581 (MRE11)
   03450 Non-homologous end-joining
    102388581 (MRE11)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102388581 (MRE11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:asn03032]
    102388581 (MRE11)
   03400 DNA repair and recombination proteins [BR:asn03400]
    102388581 (MRE11)
DNA replication proteins [BR:asn03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     102388581 (MRE11)
DNA repair and recombination proteins [BR:asn03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     102388581 (MRE11)
    BRCA1-C complex
     102388581 (MRE11)
   NHEJ (non-homologous end-joining)
    MRX complex
     102388581 (MRE11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 102388581
NCBI-ProteinID: XP_006018710
UniProt: A0A1U7REU1
LinkDB All DBs
Position
Unknown
AA seq 715 aa AA seqDB search
PSNAQPCTRRDDENTFKILVATDIHLGYLEKDPVRGNDTFVTFDEILRHAQENEVDFILL
GGDLFHENKPSRKTLHTTLEILRKYCMGDRPVQFEIVSDQSVNFSFSKFPWVNYQDGNLN
ISVPVFSIHGNHDDPTGADALCALDILSCAGLLNHFGRSVSVEKIDISPVLLRKGSTKIA
LYGLGAIPDERLYRMFVSKQVTMLRPKEDEDSWFNLFVIHQNRSKHGATNYIPEQFLDDF
IDLVIWGHEHECKIAPIRNEQQLFYVSQPGSSVVTSLSPGEAVKKHVGLLHIKGKRMNMQ
KIPLETVRCFYMEDIVLANHPDIFNPDDPKVTQTIQAFCMEKVDAMLDKSEMERLGSPRQ
PEKPLIRLRVDYTGGFEPFNVHRFSQKFMDRVANPKDIVHFFRHREQKEKNENEINFGKL
FSRPASEGTTLRVEDLVKQYFQTAEKKVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKF
QLEKTQRFLKERRTDAEEEKIDEEVRKFRDTRKKNTEEEDEEVREAMTRARAHRSQETVH
TTFSSDDELMDTRTMEQKGSDDSDGGFSISATTSRGRGRGRTQARGTRGQNAATRGVSRR
GRGNTSQESSSSSRTYKPIATPTKNMSIFDAFKSSRQQPSRNSSAKNYSEHIVDDDSDVE
EIPFTASKVNQRVSSTSTFSKTGSQSQMSKGVDFESDEDEYDPFKNTTVSRRNRR
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
cccagcaacgcccagccctgcaccaggagggatgatgaaaatacttttaaaattctggtg
gctactgacattcaccttggatacctggagaaggatccagttcgtggaaatgatacattt
gtaacttttgatgaaattttgagacatgctcaagaaaatgaagtggactttattttatta
ggcggggatctctttcatgaaaacaaaccctcaagaaaaacgctacatactacccttgag
atattaagaaaatactgtatgggagatcgtcctgtgcagtttgaaattgtgagtgaccag
tcagtcaattttagctttagcaagtttccatgggtgaactaccaagatgggaatctcaac
atttctgttccagtttttagtatccatggcaatcatgatgatcccacaggggcagatgca
ctgtgtgcactggatattttaagctgtgcaggattgctgaatcattttggacgctcggtg
tctgtagagaagatagatattagtcccgttttacttcgcaaaggcagcacaaaaattgct
ctgtatggattgggggctattccggatgagaggttgtatcgtatgtttgttagtaagcaa
gtaactatgctgaggccaaaagaagatgaagatagctggtttaatttgtttgtgattcat
caaaacaggagtaaacatggagccaccaattacattccagaacagtttttagatgacttt
attgaccttgttatttggggtcatgaacatgagtgtaaaatagcacccatcagaaatgaa
cagcaacttttctatgtatcacagccgggaagttcagtagttacttctctatcaccaggg
gaagctgtgaaaaagcacgttggtttgctgcacattaaaggaaagagaatgaacatgcag
aagattcctcttgagacagtacgatgcttctatatggaagatattgtccttgctaatcat
ccagacatttttaacccagatgatcctaaagtaacccaaacaatacaagcattttgtatg
gaaaaggttgatgcaatgctggacaagtcagaaatggagcgtctgggaagtccacgtcag
ccagaaaagcccctcataagattacgagtcgactacacaggaggttttgaaccatttaat
gttcatcgtttcagccagaaattcatggatagggtagctaacccaaaagacatcgttcat
ttttttagacatcgtgagcaaaaagagaaaaatgaaaatgagattaattttgggaagctt
tttagcagacctgcctctgaagggacaaccttgagagtggaggatcttgtaaagcagtac
ttccagacagcagagaagaaagtgcaactttcacttttgactgaaagaggaatgggagaa
gcagtacaagagtttgtggacaaagaagagaaagatgctatagaagaattggtgaaattt
cagttagagaaaacacagagatttcttaaggaacgtcgtactgatgcagaggaagaaaaa
atagatgaggaggtgcgaaaatttagagacaccagaaaaaagaatactgaagaagaggat
gaagaagtccgggaggcaatgaccagggctagagcccaccgatctcaggaaactgttcac
accactttctctagtgatgatgaacttatggacacgagaacaatggaacaaaaaggtagt
gatgactcggatggtggcttctccatctctgcaacaaccagcagaggaagagggcgagga
aggactcaagcaagaggtacaagaggacaaaatgcagccacaagaggagtgtctcgaaga
ggaagaggaaatactagccaggagtcatccagtagcagtagaacttacaagcctatagct
acgcctaccaagaatatgtctatctttgatgcctttaaatcttcaaggcaacagccttct
cggaattcatctgctaagaattactcagagcatattgtagatgatgactcagatgtggaa
gaaattccttttactgcttctaaagtaaatcagagggtgtcaagtacatctacattcagc
aaaacaggttctcaaagccagatgagtaagggagttgattttgaatcggacgaggatgaa
tatgaccccttcaaaaataccactgtatcaagaagaaatagaagatga

DBGET integrated database retrieval system