KEGG   Alligator sinensis (Chinese alligator): 106721797Help
Entry
106721797         CDS       T02922                                 

Gene name
STAT2
Definition
(RefSeq) LOW QUALITY PROTEIN: signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04217  Necroptosis
asn04621  NOD-like receptor signaling pathway
asn04625  C-type lectin receptor signaling pathway
asn05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:asn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106721797 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106721797 (STAT2)
   04625 C-type lectin receptor signaling pathway
    106721797 (STAT2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106721797 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:asn03000]
    106721797 (STAT2)
Transcription factors [BR:asn03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    106721797 (STAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT_int STAT_bind TRPM_tetra FRP Syntaxin_2 DUF1804 DUF1244 FapA TraF_2 Fib_alpha LXG V_ATPase_I Fmp27_WPPW Prominin DASH_Dam1
Motif
Other DBs
NCBI-GeneID: 106721797
NCBI-ProteinID: XP_025047158
UniProt: A0A3Q0FNC1
LinkDB All DBs
Position
Unknown
AA seq 785 aa AA seqDB search
MAQWQKVQELGSAHLEQVHQLYHSDLLPMEVRHCLAAWIEDQAWQQAAEPGSSQARMLLY
ALLAKLDEQYGRCSTEADGFVLQHNLRKAKHDLQARYEECPEELANVIANLLREEKRILS
LGLEAQQAGASPTPTPPIETNRQQKIEQRLNEIQESMQDLERSVRHLEELQDTFDFVYKI
TQAHKRTNPADPELQAQTQQLQAMLNSLDQNRKGVLAKMQTLLGRVETLRDFVLKELAAW
RERQRQACLGATHDTALGSLEAWCTGVAGALFQLLRVLRTLQELRAKVSYQHDPLEMEPG
LLEHRIREQLTSLLRSAFVVEEQPAMPHPSRRQLVLRTNQKFSTCIRLLVKLQDRNQQLV
VKMECDKDTPNVKGFRRFNILTSPNKTLALDERHRKGLVCDFRHVMLKEQKVVGCGKGSK
GASEGLLPVTEELHLITFTLDYKYQDVELQLQTSTLPVVVISNVCQASAAWASILWFNLL
SRCLGFHPFTHPPQDQLFFQAPPPAPWPVLAEALSXQFMAAAGRGLDHDQLHMLAEKLFG
PDASPKSTLPWIQFSKDSPPGFSFWTWLEGILELIHKHLASLWKDGPPADRPEFCSVEPY
TKLELESLPLADIIRDYHMLAHKNVPESPLKLLYPMQPRDEAFGPYYSDSRKVDLLAQRK
YLNRRLIPVSSRQVDDSPGQTEEGAAAAPVPDPVVKLEPRDGADLVLGPEDLELIEGLSL
EPGAMEQLEESLALAGILPDVLQRGTDPYMPIPDDGVLLEPGSPESQFAEAGDMPLLQVD
SRDFQ
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtggcagaaggtgcaggagctgggcagtgcccacctggagcaggtgcatcag
ctgtatcacagcgacctgctccccatggaggtgcggcattgcctggctgcttggatcgag
gaccaggcctggcagcaggcggcagagccgggctcatcgcaggcacgcatgctgctgtac
gcactgctggcgaagctggacgagcagtatgggcgctgcagcaccgaggctgatggcttt
gtgctgcagcacaacctgcgcaaggccaagcacgatctgcaggccaggtatgaggagtgc
cctgaggagctggccaatgtcattgccaacctgctgcgggaggagaagaggatcctgagc
ctggggcttgaggcccagcaggcaggagccagccccacgcccaccccccccatagagaca
aaccgacagcaaaagatcgagcagcgcctgaacgagatccaggagtccatgcaggacctg
gaacgctcggtgcggcacctggaggaactgcaggacacctttgactttgtctacaagata
acccaggctcacaagaggacaaaccctgcagaccctgagctgcaggctcagactcagcag
ctgcaggctatgctaaacagcctggaccagaaccgcaagggcgtgctggcaaagatgcag
acactgttggggcgcgtggaaacgctgcgggactttgtgctgaaggagctggcagcctgg
cgtgagcggcaacgccaggcctgcctgggcgccacccatgacacagccctgggctccctc
gaggcctggtgcacgggggtggcgggggcattgtttcagctgctgcgggtgctacggacg
ctgcaggagctgcgtgccaaggtcagctatcagcacgacccgctggagatggaaccgggg
ctgttggagcaccgcattcgcgagcagctcaccagcctcctgcgcagcgcctttgtggtg
gaggaacagccggccatgccccaccccagccggcgccagctggtgctcaggaccaaccag
aagttctccacctgcatcaggctcctggtgaagctgcaggaccggaaccagcagctggtg
gtgaagatggagtgtgacaaggataccccaaatgtgaaggggttccggcgcttcaacatc
ctgacgtcgcccaacaagacactggcgctggacgagaggcatcgcaaagggctggtctgc
gacttccgccatgtgatgctgaaggagcagaaggttgtgggctgtggcaagggcagcaaa
ggtgccagcgagggcctgctaccggtaacggaggagctgcacctcatcaccttcacacta
gactacaagtaccaggacgtggagctgcagctgcagacatccactctgcccgtggtggtc
atctccaatgtctgccaggcctcggctgcctgggcttccatcctctggttcaacctgctc
agccgctgcctgggcttccatcctttcacccatcccccccaggaccagctgttcttccag
gcgcctcccccagctccctggcccgtgctggccgaggcgctgagctagcagttcatggct
gctgctgggcgcgggctggaccacgaccaactgcacatgctggctgagaagctcttcgga
ccagatgcatcccccaagagcaccctcccctggatccagttctccaaggactcccctccc
ggcttctccttctggacctggctggaggggatcttggagctgatccataagcacctcgcc
tcgctgtggaaggatgggcctcctgcagaccgccccgagttctgctccgtggagccctac
accaagctggagctggagtcactgccgctggccgacatcattcgtgactaccacatgctg
gcacacaagaacgtgcccgagagcccgctcaaactgctgtaccccatgcagccccgagac
gaggcctttgggccctactacagcgacagccgcaaagtggatctgctggcccagaggaag
tatctgaaccgccggctcatcccagtctcctctaggcaggtggatgactcccctggccag
accgaggagggggcggctgcagccccagtcccagaccctgtggtgaagctggagcccagg
gatggggcagatctggtactggggccagaggacctggagctcattgaggggctgagccta
gagcccggggccatggagcagctggaggaaagcctggcgctggcaggcatcctgcccgac
gtgctgcagcgagggaccgacccctacatgccgatcccggacgacggggtcctgctggag
ccaggcagcccagagtcccagtttgccgaggctggggacatgccccttctgcaggttgac
tccagggacttccagtga

DBGET integrated database retrieval system