KEGG   Alligator sinensis (Chinese alligator): 106722510
Entry
106722510         CDS       T02922                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106722510 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:asn04052]
    106722510 (EPO)
Cytokines and growth factors [BR:asn04052]
 Cytokines
  CSF and other factors
   106722510 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 106722510
NCBI-ProteinID: XP_025066916
UniProt: A0A3Q0H4B8
LinkDB
Position
Unknown
AA seq 177 aa
MGVGAGLWTLLSMLLLMPGPVQAGAPRPMCDPRVLEMFIRETQDAEKAAAACGAACDLPD
ILMLPETKVNFNEWQQMSWPARVQEVWGGHTLLVTALCRARELVTEPGTRVTLERMHNVV
RGVGQILRNHEAKPPPLAPPPGSPARSVLRLLGAQSNFLRGKVSLLLADACRGGGPT
NT seq 534 nt   +upstreamnt  +downstreamnt
atgggagtaggggctgggctctggactctgctgtcgatgctgctgctgatgccggggcca
gttcaggcaggcgccccccggcccatgtgtgacccccgtgtgctggagatgttcatccgt
gagacccaggatgcagagaaggcagcagctgcctgcggagctgcgtgcgacctgccggac
atcctgatgctgcctgaaacaaaagtgaactttaatgagtggcagcaaatgagttggcca
gcgcgggtgcaggaggtgtgggggggtcataccctcctggttactgccctctgccgtgcc
cgggagctggtgactgagccggggacacgggtgacgctggagcggatgcacaacgtggtg
cgcggcgtgggccagatcctgcgcaaccatgaggccaagcccccacccctggccccgccc
ccaggcagccctgcccgctctgtgctccgcctcctgggggctcagtccaacttcctgcgg
ggcaaagtctcactcttgctggccgatgcctgccgggggggcgggcctacgtga

DBGET integrated database retrieval system