KEGG   Alligator sinensis (Chinese alligator): 112549152Help
Entry
112549152         CDS       T02922                                 

Gene name
IL9
Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112549152 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:asn04052]
    112549152 (IL9)
Cytokines and growth factors [BR:asn04052]
 Cytokines
  Interleukins
   112549152 (IL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 112549152
NCBI-ProteinID: XP_025051805
UniProt: A0A3Q0G091
LinkDB All DBs
Position
Unknown
AA seq 131 aa AA seqDB search
MLLYILFSCLLLVVQARTICRVRETIDLTNTLLGKLEDCECNETNHNSCICLPIPNNACL
TCFEKHNEEIEEKLSTIGSEGRRLYRSLQQLQNWKLCAPLFTCTETCDASPGNMMTFLTS
VRAALQKLQHQ
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtatatcctcttctcctgtttgctgcttgttgtgcaagcacgtacgatttgc
cgagttcgtgaaactatcgatcttacaaacacgttacttggaaagcttgaagactgtgag
tgtaatgaaactaaccataattcatgcatatgtcttcccattccaaacaatgcctgttta
acatgctttgagaaacacaatgaagaaatagaagaaaaactgtctactattggcagtgaa
ggtaggcgtttgtatcgctcccttcagcaacttcaaaactggaagctgtgcgcaccactc
tttacttgtactgaaacctgcgatgcttccccagggaatatgatgactttcttaacatca
gtccgagcagctttgcaaaaactgcagcaccaataa

DBGET integrated database retrieval system