KEGG   Alligator sinensis (Chinese alligator): 112552056Help
Entry
112552056         CDS       T02922                                 

Definition
(RefSeq) transcriptional regulator ERG homolog
  KO
K09435  transcriptional regulator ERG
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:asn03000]
    112552056
Transcription factors [BR:asn03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    112552056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 112552056
NCBI-ProteinID: XP_025072262
UniProt: A0A3Q0HKS2
LinkDB All DBs
Position
Unknown
AA seq 149 aa AA seqDB search
WQFLLELLSDSANVGCIAWEGADGEFKMTDPDEVARRWGRRKSKPNMNYDKLSRALRYYY
DKSIMTKVHGKRYAYKFDFRGLSQTHQADPGAYRAPAPALPCLGPCHAQPKAGFGLAPGP
GVAPSFFTSPYWGGGGLYQSPGGYLNSTF
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
tggcagttcctgctggagctgctgtcagacagcgccaacgtgggctgcatcgcctgggag
ggggcggacggcgagttcaagatgaccgacccagacgaggtggcacgacgctggggccgg
cgcaagtccaagcccaacatgaactacgacaagctgagccgggcgctgcgctactactat
gacaagagcatcatgaccaaggtccacggcaagcgctacgcctacaagttcgacttccgg
ggcctcagccagacccaccaggctgaccctggtgcctaccgagcccccgctccagccctg
ccctgcctggggccctgccatgcgcagcccaaggcaggctttggcctagcgcctggccct
ggggtagcccccagcttcttcaccagcccctactgggggggtggggggctctaccagagc
cccgggggctacctcaactccaccttttag

DBGET integrated database retrieval system