KEGG   Candidatus Arthromitus sp. SFB-mouse-NL: SFBmNL_00644Help
Entry
SFBmNL_00644      CDS       T03243                                 

Gene name
prkC
Definition
(GenBank) Serine/threonine protein kinase PrkC, regulator of stationary phase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aso  Candidatus Arthromitus sp. SFB-mouse-NL
Brite
KEGG Orthology (KO) [BR:aso00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aso01001]
    SFBmNL_00644 (prkC)
Enzymes [BR:aso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SFBmNL_00644 (prkC)
Protein kinases [BR:aso01001]
 Serine/threonine kinases: Other
  Bacterial family
   SFBmNL_00644 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Haspin_kinase Kinase-like Pkinase_fungal RIO1 Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AID44552
LinkDB All DBs
Position
648791..650773
Genome map
AA seq 660 aa AA seqDB search
MIGKVIGGRYEIIEKLGEGGMANVYKAKCKILKRFTTIKILKQELTNDEEFVRKFKDEAM
EVAKLSDNNIVKVYDIGVEDNLHYIVMEYIDGKTLKEYISEKGVLSIKEALDFSIQICNG
LVIAHDIELIHRDIKSQNILVSNHGNIKVTDFGIAKSSDSATITNSGKILGSAYYISPEQ
ARGNFVDCRSDIYSFGVVMYEMFTGRLPFTHGTPVNVALQHIQVDPVEPMDIVKKLPIGI
NNLIIKCLQKNPALRYQNSKELRDDLKALQNNKKHFVTRCNMLDKTTVMSAVTPPIPTKL
KKNNVFRNIVIVLLLILAIIVSIMSFKFSGLVGKFSADISVPSFLGKTGVQYERELEELG
LNYKVSGYVESDLEKNFVVDTYPKEGTIVKKGDTIKIVLSDGVELVDVPNIVNMTLDKAR
LVLQREGLTIGNIEERFSDVYERGVIMIQNPSQTSKIGKNETISVVISRGSETELVVVPQ
FVGKDIVEAQNLAVLNGINIKLKSVDTTNQENDKKIFYQSVPDGIEIKPTVEIELSYYNY
VKKQFDDDTSPDKDLDKEPDDTVEDNVKDELTSSESNDETDEGNKENLIGQSETINQEGN
MTKVPDIIDYTVKDAREILKESDLELDANNFDDTDVIKKIDCLVGDEVISGSQIKIEEVY
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgataggtaaggtaataggtggcagatatgaaataatagaaaaacttggcgaaggtgga
atggctaatgtatataaggccaagtgtaaaatattaaagagatttactacaattaagatt
cttaaacaggagcttactaatgatgaggaatttgtacgtaagtttaaggatgaggcaatg
gaagttgctaagttatctgataataatatagtaaaggtttatgatataggagtcgaagat
aacttgcactatattgtaatggaatatatagatggaaagactttgaaggagtacataagt
gaaaaaggagtactttctataaaggaagcattagattttagtatacaaatttgtaatggg
ttggttattgcccatgatatagaattaatacatagagatataaagtctcaaaatatttta
gtttcgaatcatggtaatataaaagtgactgattttggaatagcaaagtcctctgattct
gccacaataactaattcaggaaagatattaggatcggcatattacatatctccagaacag
gctcgtggaaatttcgtagattgtagaagtgatatttattcttttggtgttgtgatgtat
gaaatgtttacaggaaggttaccatttactcatggaacgccggttaatgttgcgttgcaa
catatacaagtagatccagttgaacctatggatatagttaagaaattacctattgggata
aataatcttataataaagtgtcttcaaaagaatcctgcattaagatatcaaaattctaag
gagttaagagatgatctgaaagcactgcaaaataataaaaagcactttgttacaagatgt
aatatgcttgataaaaccacagttatgtctgcagtaacaccaccaattccaactaagtta
aagaaaaataatgtatttagaaatattgtcatcgttcttttgcttatactcgctattatt
gtttcaataatgagttttaaatttagtgggttagttggaaaattttctgctgatatcagt
gttccttcatttttggggaaaactggggttcaatatgagcgagagttggaagaattaggt
ttaaattataaagtttctggatatgtggaaagtgatttagaaaagaattttgtagttgat
acttatcctaaagagggaacaatagtaaaaaaaggagatacgattaaaattgtattaagt
gatggagttgaactcgtagatgttcctaatatagttaatatgactttagataaagctaga
ttggtattgcaaagagaaggacttactattgggaatatagaagaaagatttagtgatgta
tatgagcgtggtgtaataatgattcaaaatcctagtcagacttcaaaaataggtaagaat
gaaactatatctgttgttataagtaggggatctgaaacggaacttgttgttgttcctcaa
tttgtaggtaaggatatagttgaggcacagaatttagctgtattgaatgggattaatata
aaattgaagtcggttgatacaactaatcaagagaatgataagaaaatattttatcagtct
gttccagatggaattgagattaagccaacagttgagattgagttaagttattataactat
gttaaaaagcaatttgatgatgatacttctccagataaagatttagataaagaaccagat
gacactgttgaagataatgttaaagatgagcttaccagcagtgaaagtaatgatgagact
gatgaaggcaataaagaaaatttaataggacaaagtgaaactattaatcaagaaggtaat
atgactaaggtaccagatataattgattacactgtgaaggatgcacgtgaaattcttaag
gagagtgatcttgaattagatgctaacaattttgatgatacagatgttattaaaaaaatt
gattgcttagttggagatgaagtgatttcagggtcgcaaataaagatagaagaagtatat
tga

DBGET integrated database retrieval system