KEGG   Candidatus Arthromitus sp. SFB-mouse-NL: SFBmNL_01271Help
Entry
SFBmNL_01271      CDS       T03243                                 

Definition
(GenBank) 2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase I beta
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
aso  Candidatus Arthromitus sp. SFB-mouse-NL
Pathway
aso00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aso01100  Metabolic pathways
aso01110  Biosynthesis of secondary metabolites
aso01130  Biosynthesis of antibiotics
aso01230  Biosynthesis of amino acids
Module
aso_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:aso00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SFBmNL_01271
Enzymes [BR:aso01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     SFBmNL_01271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 NeuB
Motif
Other DBs
NCBI-ProteinID: AID45175
LinkDB All DBs
Position
complement(1285225..1286220)
Genome map
AA seq 331 aa AA seqDB search
MIIFFKKDIDRKCSIENIKHISGLDFVPFNFDENYIGIHILSDVDEKFIYDSIDGIKDIV
YVDKPYKFVSRDFKKEDTIVHIGDVKIGGEYFETIGGPCSFENEDMFMEIAKSLKELGVN
IIRGGAFKPRTSPYFFQGIGKYALISMRKITSDLGLKLVSEIVSTEDIEFFNEYVDVFQV
GARNMQNFELLKKLGECNKPVLLKRGLSATIEEFLLSAEYIVSKGNINVILCERGIRTFE
KSTRNTLDISAVPLVKKLSHLPIIVDPSHASGQFDLVEPLALASVSAGCNGIMVEVHNDP
ENALSDGYQSIKFKRFDDMNKKIHKIRKSLF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatcatatttttcaagaaggatattgatagaaaatgttctatagaaaatataaaacat
atttctggattagattttgtgccttttaattttgatgaaaattatataggaatacatatc
ttaagtgatgttgatgagaagtttatatatgatagtattgatggaattaaagatatagtt
tatgtagataaaccttataaatttgttagtagagattttaagaaagaggatactattgta
catattggggatgttaagataggtggagaatattttgaaactataggtggaccatgttct
tttgaaaatgaagatatgtttatggagatagctaagagtttaaaggagttaggggtaaat
ataataaggggtggtgcatttaagcctcgaacctctccttatttttttcagggaattggt
aaatatgctttgataagtatgagaaaaattacgtcagatcttggtctaaagcttgttagt
gagattgtgtctacagaggatatagaattttttaatgaatatgtagatgtttttcaggtt
ggagcccgtaatatgcagaattttgaattgttaaagaaacttggagagtgcaataagcca
gttttgttaaagagaggattaagtgcaacgattgaagagtttttacttagtgctgagtat
attgtttcaaagggaaatataaatgttatactttgtgagagaggaatcagaacttttgag
aagtctacaagaaatactttagatatatcagcagttcctcttgttaagaagttatctcat
cttcctataatagttgatcctagtcatgcttctggccaatttgatttggttgagcctctt
gcattagcttctgtttcagctgggtgtaatggaattatggttgaggttcataatgatcct
gaaaatgcattatctgatggatatcaatcaataaaatttaaacgatttgatgatatgaat
aagaaaattcataagataaggaagagtttattttaa

DBGET integrated database retrieval system