KEGG   Aneurinibacillus soli: CB4_00742Help
Entry
CB4_00742         CDS       T05174                                 

Gene name
hisE
Definition
(GenBank) Phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
asoc  Aneurinibacillus soli
Pathway
asoc00340  Histidine metabolism
asoc01100  Metabolic pathways
asoc01110  Biosynthesis of secondary metabolites
asoc01230  Biosynthesis of amino acids
Module
asoc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:asoc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CB4_00742 (hisE)
Enzymes [BR:asoc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     CB4_00742 (hisE)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     CB4_00742 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG DUF3821
Motif
Other DBs
NCBI-ProteinID: BAU26615
UniProt: A0A0U5B8T1
LinkDB All DBs
Position
729964..730617
Genome map
AA seq 217 aa AA seqDB search
MNVQDLKFDSNGLIPAIVQDAQSKEVLTLAYMNEESLKKTIETRETWFWSRSRQELWNKG
ATSGNTQRVVDITYDCDGDSLVVKVIPAGPACHKNVYSCFADSLLTGEAASGNPEPTAVE
ADGRFDIINKLESLIAKREAEMPEGSYTTYLFREGVDKILKKVGEEASEVIIAAKNRSHD
ELRYEASDLIFHLLVLLREQKLPFDAVLQELEKRHVK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgcaagatttgaaatttgacagcaacggtttaattccagcgattgtgcaggat
gcgcagagtaaggaagtgctgacgcttgcctacatgaatgaagagtcgctcaaaaaaacg
atcgagacacgcgaaacatggttctggagccgttcacgccaggagctgtggaacaaaggg
gccacatcgggcaatacacagcgtgtagtcgatattacgtatgactgcgatggagattcc
ctcgttgtaaaagtaattccggcaggtccagcctgccacaaaaatgtatactcttgcttc
gcggattcactgctgacaggggaagcggcatctggaaatccggaaccgacagcagtcgag
gcagatggtcgatttgatatcattaataagctggagtctcttattgcgaagcgagaagcg
gagatgccggaaggatcgtatacaacgtatttgttccgtgaaggcgttgataaaatcctg
aaaaaagttggggaagaagcgagcgaagtgattatcgcggcgaaaaaccgcagtcatgat
gagctgcgctatgaagcgtctgatttgattttccacctgcttgtactgttacgcgagcag
aagctaccgttcgatgccgtgcttcaagagctggagaaacgccacgtgaaataa

DBGET integrated database retrieval system