KEGG   Aneurinibacillus soli: CB4_01598Help
Entry
CB4_01598         CDS       T05174                                 

Gene name
cfiB_1
Definition
(GenBank) 2-oxoglutarate carboxylase small subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
asoc  Aneurinibacillus soli
Pathway
asoc00061  Fatty acid biosynthesis
asoc00620  Pyruvate metabolism
asoc00640  Propanoate metabolism
asoc01100  Metabolic pathways
asoc01110  Biosynthesis of secondary metabolites
asoc01120  Microbial metabolism in diverse environments
asoc01130  Biosynthesis of antibiotics
asoc01200  Carbon metabolism
asoc01212  Fatty acid metabolism
Module
asoc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:asoc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CB4_01598 (cfiB_1)
   00640 Propanoate metabolism
    CB4_01598 (cfiB_1)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CB4_01598 (cfiB_1)
Enzymes [BR:asoc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CB4_01598 (cfiB_1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CB4_01598 (cfiB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 GARS_A RimK Oxidored_nitro ATPgrasp_ST ATPgrasp_Ter ATP-grasp_5 Glyoxalase_4 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: BAU27424
UniProt: A0A0U5AZI9
LinkDB All DBs
Position
1558891..1560246
Genome map
AA seq 451 aa AA seqDB search
MFKKVLIANRGEIAVRVIRACRELGIQTVAVYSEADREALHVRLADEAYCIGPTPSKDSY
LNMTNLMSVATKAGVDAIHPGYGFLAENADFAEICAACNITFIGPKPEAIIKMGDKNEAR
DTMKNAGVPIVPGTDGLIEDIDEAIRIAEDAGYPVIIKATAGGGGKGMRVARSQEELVAS
VRQAQSEAKNAFGNPGVYLEKYLEDTRHIEIQVIADKHGNVCHLGERDCSIQRRHQKLVE
EAPSPALDPETREQMGSAAVAAARAVNYHGAGTVEFLLDKDGRFYFMEMNTRIQVEHPVT
ELITGIDLIKEQLMVAADYPLSFSQEEVRINGWALECRINAENPAKKFMPSPGKIQEYLP
PGGFGVRVDSAAYQGYQISPFYDSMIAKIIVWGKDRNDAIARMKRALSEMVVDGVHTTIP
FHLKLLEHEMFVEGNFNTKFLEMYDLKLEEK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaagtattaattgcgaatcgtggagagattgcagttcgtgttattcgtgcg
tgtcgcgaactaggaattcaaacggtagcggtttattccgaggcggatcgtgaggccctt
catgtgcgtcttgcagatgaagcatactgtattggaccgacaccatcaaaagacagctat
ttgaatatgactaacctgatgagcgtagcgaccaaagcgggcgtagatgcgattcaccca
ggctatggattccttgctgagaatgcagattttgccgagatttgtgcggcgtgcaacatc
acatttatcgggccaaaaccggaagccattatcaagatgggcgacaagaatgaagcccgt
gacacgatgaaaaacgcaggtgtaccgatcgtaccaggtacggacggtctgattgaagac
atcgatgaggcgatccgcattgcagaagatgctggttatccggttatcatcaaggcgaca
gctggcggtggcggtaaagggatgcgcgtagcgcgttctcaggaagaacttgttgcttcc
gtgcgccaggcacagagcgaagcgaagaatgcattcggtaaccctggtgtttatcttgag
aaatatctcgaagatacacgccacatcgagattcaggtcattgcggacaagcatggcaac
gtctgtcacttaggcgagcgcgattgctcgattcagcgtcgtcaccagaagctcgtagaa
gaagctccgtctccggcgcttgatccggaaacacgcgaacagatgggaagtgccgcagta
gctgcagctcgtgcagttaactaccatggcgcaggtaccgtcgaattcctgctcgataaa
gatggccgtttctacttcatggagatgaacacacgtatccaggtagagcatccggttaca
gaattgattaccgggattgacctgattaaagaacaactcatggtagcggcagattatccg
ctttctttcagtcaggaagaggttcggattaacggctgggctcttgagtgccggatcaat
gcagagaatccggcgaagaaattcatgccgtctccgggcaaaatccaggaatacttaccg
ccaggtggctttggtgtgcgcgtagacagtgctgcttaccagggctatcagatttcaccg
ttttatgattcgatgattgccaaaatcatcgtctggggcaaagatcgcaatgatgcgatt
gcccgcatgaagcgtgcgctgtctgagatggtagtagacggtgttcatacaacgatcccg
ttccacctcaagcttctcgaacatgagatgttcgtagaaggcaacttcaatacgaagttc
cttgagatgtacgatttgaaacttgaagagaaataa

DBGET integrated database retrieval system