KEGG   Aneurinibacillus soli: CB4_02021Help
Entry
CB4_02021         CDS       T05174                                 

Gene name
mgrA_2
Definition
(GenBank) HTH-type transcriptional regulator MgrA
Organism
asoc  Aneurinibacillus soli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_24 B-block_TFIIIC TrmB HTH_Crp_2 HTH_36 HTH_34 Fe_dep_repress PadR HTH_37 HTH_3 FeoC HTH_IclR TFIID-18kDa DUF2250 Rrf2 RNA_pol_Rpc34 FtsK_gamma HxlR HTH_20 DUF4423 z-alpha Penicillinase_R DDE_Tnp_IS1 HTH_47 HTH_19 DUF4953 TRI5
Motif
Other DBs
NCBI-ProteinID: BAU27847
UniProt: A0A0U5BCD9
LinkDB All DBs
Position
1972442..1972888
Genome map
AA seq 148 aa AA seqDB search
MSYKIDESLGFILSNTQRKLSHFLLSKFKPYDITTEQWVLVAKLGEENGITQKDLAERIE
KDQANVTRIIDLLEKKGLVRREKNSTDRRSMLVHLTDEGKRLREMLAPIEEAVVKVSLAG
MSEEERELLKGFLSRIAANVQNEFQGQE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttataaaattgatgagtcgctcgggtttattctgagtaacacccagcggaaatta
agtcactttttgttatcgaaattcaaaccgtatgatattaccacagagcagtgggtttta
gtggctaaactaggagaagagaatggaattacacagaaggatttagccgagcgcatagaa
aaagaccaggcgaatgtgacgcggattattgacctgttagaaaaaaagggactggttaga
cgagaaaaaaacagtacagatagaagatcgatgctcgtacatctaacagatgaagggaaa
agattacgggaaatgttagctccaattgaagaagcggtagtgaaggtgtcgctggctggt
atgtctgaggaagaaagggagttgttgaaagggtttctttctcgcattgcggctaatgtg
cagaatgagtttcaaggtcaggaataa

DBGET integrated database retrieval system