KEGG   Aneurinibacillus soli: CB4_03024Help
Entry
CB4_03024         CDS       T05174                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
asoc  Aneurinibacillus soli
Pathway
asoc00220  Arginine biosynthesis
asoc00250  Alanine, aspartate and glutamate metabolism
asoc00270  Cysteine and methionine metabolism
asoc00330  Arginine and proline metabolism
asoc00350  Tyrosine metabolism
asoc00360  Phenylalanine metabolism
asoc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asoc00401  Novobiocin biosynthesis
asoc01100  Metabolic pathways
asoc01110  Biosynthesis of secondary metabolites
asoc01130  Biosynthesis of antibiotics
asoc01210  2-Oxocarboxylic acid metabolism
asoc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:asoc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CB4_03024
   00270 Cysteine and methionine metabolism
    CB4_03024
   00220 Arginine biosynthesis
    CB4_03024
   00330 Arginine and proline metabolism
    CB4_03024
   00350 Tyrosine metabolism
    CB4_03024
   00360 Phenylalanine metabolism
    CB4_03024
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CB4_03024
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    CB4_03024
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:asoc01007]
    CB4_03024
Enzymes [BR:asoc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     CB4_03024
Amino acid related enzymes [BR:asoc01007]
 Aminotransferase (transaminase)
  Class I
   CB4_03024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP OKR_DC_1 DUF3088
Motif
Other DBs
NCBI-ProteinID: BAU28847
UniProt: A0A0U5B601
LinkDB All DBs
Position
complement(2963461..2964639)
Genome map
AA seq 392 aa AA seqDB search
MKLAQRVAQITPSKTLAITAKAKELKSQGYDVVGLGAGEPDFNTPQHIIDAAVKAMEEGQ
TKYTAASGIVELKQAICDKLQRDNNLTYKSSQIVVCNGAKHALYNLFQAILDPGDEVIVP
IPYWVSYPEMVTLADGIPVFVEGAEANEFKITPQQLRDAITDKTRAVVINSPSNPTGSIY
SRDELQAIADVCVEKDILIVSDEIYEKLVYDGAEHVSIASLGQEVYDRTVVINGMSKPYS
MTGWRIGYAAGNEGLIKAMTNLSSHSTSNPTTFAQYGALAALEGSQEALEMMRVEFDKRR
KAVVDLMNDIDGIHCVAPKGAFYLFANVSEAMKKGGYSDVDAWAEALLAKEYVALIPGSG
FGAPNHIRISYATSLEQLQKGLARIKKFVEGE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagcacagcgcgtagcgcagattactccatccaagacgcttgccatcacggca
aaagcgaaagaactgaaaagccagggttatgatgtggtaggtcttggtgccggtgaaccg
gactttaacactccgcagcatattattgatgcggctgttaaagcgatggaggaaggccag
acaaaatacacagcagcgtctggtattgtagaattaaagcaggcaatctgcgataaactt
cagcgcgataataacctgacatataagtcgtcgcagatcgttgtatgcaacggtgcgaaa
catgcattatataacttgttccaggcaattcttgatccgggcgatgaagtaatcgtaccg
attccgtactgggtaagctacccggaaatggtaactcttgcggatggtattccggtattc
gtagaaggtgcggaagcgaacgaattcaaaattacgccgcagcagctgcgtgacgcgatt
accgacaaaacacgtgcggtcgtgattaactccccgagcaatccgactggtagcatctac
agccgtgacgagctgcaggcgattgcagacgtatgtgtggaaaaagacatcctgatcgta
tcggatgaaatttatgagaagcttgtatatgatggagcagaacatgtaagcatcgcaagc
cttggacaggaagtgtatgaccgtacggttgtcattaacggtatgtctaaaccatattcc
atgacaggctggcggattggctatgcggcagggaacgaagggcttattaaagcgatgacg
aacctgtcaagccacagtacatctaacccgacaacatttgcacagtacggtgcacttgca
gcactcgagggctcgcaggaagcgcttgagatgatgcgtgttgaattcgacaagcgccgc
aaagcagtagtagacctgatgaacgacattgacggcattcactgtgtggcgccgaagggt
gcattctacctgtttgcaaacgtaagcgaagcgatgaaaaaaggcggctattccgatgta
gatgcatgggcagaagcactgctggcaaaagaatacgtagctcttattccgggcagtggt
ttcggtgcgccgaaccatattcgtatttcatatgcaacttcgcttgaacagctccaaaaa
ggtctggcgcgtatcaaaaagtttgtagaaggcgaataa

DBGET integrated database retrieval system