KEGG   Acinetobacter soli: BEN76_03620Help
Entry
BEN76_03620       CDS       T04684                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
asol  Acinetobacter soli
Brite
KEGG Orthology (KO) [BR:asol00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BEN76_03620
Enzymes [BR:asol01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BEN76_03620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 Glutaredoxin DAO NAD_binding_8 K_oxygenase Cytochrom_C_2 FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: APV35155
UniProt: A0A1P8EG43
LinkDB All DBs
Position
739507..741066
Genome map
AA seq 519 aa AA seqDB search
MLDQNIKTQLKTYLERLESPIELVAALDDSDKSAKIKELVTEIAELSDRVTARFDGQNTR
RPSFGIAKAGEQPRVFFAGLPMGHEFTSLILALLQVSGYAPKVAPELLEQIKGLQVSDHF
DVFVSLSCHNCPDVVQALNLIAIYNPNATATMIDGAFFQDEVEERKIMAVPMVFQNGQHI
GQGRMTLEEIVAKLDNNSAEKDAAAINAKAAFDVLVVGAGPAGGTSAIYAARKGIRTGMI
AERFGGQVMDTMDIENFTSVQKTLGPKFATDMEAHIREYDVDIMNLQRVSKITGADQTAN
GLVHLELENGAKVESKTVILSTGARWRKMNVPGEDEYATRGVAYCPHCDGPLFKGKKVAV
IGGGNSGVEAAIDLAGIVEHVTLIEFDTKLRADQVLQDKLNSLSNATVITHALSTEVVGD
GSQVTGLKYKDRGTDTEYTLELSGIFVQIGLLPNTDFLKGTVDLNTRGEIIIDERNETNV
KGVFAAGDCTTVPYKQIIIATGEGAKAALSAFDYIIRNG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaaaatatcaagactcaacttaaaacttacctagaacgcttagaaagccca
atcgaactggttgctgcgctcgatgattcggataaatccgcaaagatcaaagaactggtg
actgaaatcgcagaactctctgatcgtgtaacggctcgctttgatggtcagaatacacgt
cgtccaagtttcggtattgccaaagcgggtgaacagccacgtgtgttttttgctggcttg
ccaatgggccatgagttcacctcattgattctggcgttgctacaggtatcaggctatgcc
cctaaagttgcgcctgagcttttagagcagattaagggcttgcaggtgagtgatcatttt
gatgtatttgtgtcgttaagctgccataactgtccagatgttgtacaggccctcaacctg
attgccatttataacccgaatgcaacagccaccatgattgacggtgccttctttcaggat
gaggttgaagaacgcaagatcatggctgtgccgatggtgttccaaaacggtcagcatatt
ggtcagggccgtatgacgcttgaagagattgtagctaaactcgacaataattcggctgaa
aaagacgctgcggccattaatgctaaagctgcctttgatgtgctggtggtcggtgccggc
cctgcgggtggaacctcggccatttatgccgcacgtaaaggcattcgtaccggtatgatc
gcagagcgctttggcggtcaggtcatggacaccatggacattgaaaactttacctcggta
caaaaaaccttggggccgaagtttgccaccgatatggaagcacatattcgtgaatacgat
gtcgatatcatgaacttgcagcgtgtgagcaaaatcaccggtgcagaccaaaccgcaaat
ggtctggtgcatctcgagcttgaaaatggcgctaaagttgaatcaaaaaccgtcattctt
tctactggtgcgcgctggagaaagatgaatgttccgggtgaggatgaatatgccacccga
ggtgttgcatactgcccacactgtgatggtccgttgtttaaaggcaagaaagtagcggtg
attggtggtggtaactcgggtgttgaagctgcgattgatctggctggaattgttgaacat
gtgacgctgattgagtttgataccaaacttcgtgccgatcaggtcttgcaagacaagctg
aacagtttgagcaatgccaccgtgatcacgcatgctttatccactgaagtggtgggagac
ggcagtcaagtgacgggtctgaaatataaagaccgtggcactgatacggagtatacgctt
gagctgtctggtatttttgtacagatcggattgttgccgaacaccgacttcttaaaaggc
acagtggatttaaatacacgtggtgagatcattattgatgagcgtaacgaaaccaatgtg
aagggtgtgtttgctgcgggtgactgtaccacggtaccgtacaagcagatcattattgca
acaggtgaaggggccaaagccgcattgtctgcctttgattatattattcgcaacggttaa

DBGET integrated database retrieval system