KEGG   Acinetobacter soli: BEN76_03690Help
Entry
BEN76_03690       CDS       T04684                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
asol  Acinetobacter soli
Pathway
asol00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:asol00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BEN76_03690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:asol01003]
    BEN76_03690
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:asol01011]
    BEN76_03690
Enzymes [BR:asol01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BEN76_03690
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BEN76_03690
Glycosyltransferases [BR:asol01003]
 Polysaccharide
  Bacterial polysaccharide
   BEN76_03690
Peptidoglycan biosynthesis and degradation proteins [BR:asol01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BEN76_03690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: APV35167
UniProt: A0A1P8EG36
LinkDB All DBs
Position
complement(752579..754972)
Genome map
AA seq 797 aa AA seqDB search
MKFERGIGFFALIFSVLVIGGFIAFSIYVIRLDTVIRNKFEGQRWDIPAKVFARPLEIYT
NASISQANFTQELNMLGYKSSDSYTKPGSYVNQGNSMYVHTRGFDFGDSSEPEQVLEVTF
SADQVTDVRATKPSSTGIARLEPMLIGGIYPQHNEDRVLIKLNKVPKTLIEALIATEDRN
FYHHHGLSIRGTARALVSNVTGGKRQGGSTLTQQLVKNFYLSPERTLKRKVNEALMSLLL
EFHYNKDEILEAYLNEVNLGQNGNYSINGYGLASQFYFGLPLRELNVAQQAYLVGLVQGP
SLYNPWRNPEGALKRRNTVLNNMLVMGYLSQAEYEQESARPLGVLSKPSVGTAKFPDFLD
IVRRQLRSEYQETDLTNQGLRIFTTLDPIAQTRIQDAFKASVGQLAKGNPSRLRDLQGAV
LVSHPENGELVAAVGSTQDFTGFNRAVDAKRQVGSLLKPVIYLNAIESGRYNWASRIQDR
AVNVPTGSDQSWTPKNYSGGEHGEVTMAQALANSYNLSAVRLGQEFGVSAFTNKLKKFGV
TSEIPSYPSVFLGAVNMSPMEMLSIYSNFATGGFKYPTRAIRSVVDANGKVLERFGLNVE
QTIEPSLAYVLNYGLQQVMASGTGRSAYNSLPSSLKLAGKSGTTNDTRDSWFAGYSGNYV
AVVWLGLDNNKVTGLTGSSGALPVWTNVMRQLRQQPVNLKQTDDVQWQWIDVASGNLSAQ
GCGGAMYIPMLRSTVPHQATSCAYPYYQSAPVSAPMSDEDPSQNNGDNMDQYINDSENQM
QEDLSQNKVISSGSYGY
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgaacgcggcataggtttttttgcgcttattttttccgttcttgtgattggc
ggttttattgcatttagtatttatgtgattcgcctagacacggttatacgaaacaaattt
gaaggccaacgctgggatattcccgccaaggtatttgcacggccactcgaaatttatacc
aatgcttctatttcacaagccaactttacccaagagctgaatatgctcggttacaagagt
tcagacagctacaccaaacctggaagctacgtcaatcagggtaatagtatgtatgtgcat
actcgtggctttgattttggtgatagcagtgaaccagaacaagtacttgaagtgactttt
agtgccgatcaggtgactgacgtgcgggcaaccaagccatctagtacgggtattgcgcgc
ttagaaccgatgttgattggtgggatatatccacagcataacgaagaccgcgttctgatt
aaactcaataaagtgccaaaaacgcttattgaggcactaattgccacggaagaccgtaac
ttctatcatcatcatggactttcaattcgcggaactgcacgtgcactggtcagtaatgtg
acgggtggtaagcgtcagggtggctctacactgacccaacagttggttaaaaacttttat
ttaagcccggaacgaaccttaaaacgtaaggtgaatgaagcattaatgtctttattactt
gagtttcattacaataaagatgaaatccttgaagcttatttaaacgaagtcaatctgggt
caaaacggcaattactcgattaatggttacggactggcttcgcagttttatttcggtttg
cctttacgtgaactgaatgtcgcgcagcaagcctatctggtcggactggtgcaaggtcca
tctttgtataatccgtggcgtaatccagaaggtgctttaaaacgtcgtaatactgtactg
aacaatatgctggtcatgggctatttgagccaagcagaatatgagcaagaaagtgcacgc
ccacttggtgtattgtctaaaccaagcgtaggcacagcaaagtttccagattttctcgat
attgtgcgtcgtcaattgcgttctgaatatcaagaaaccgatttgaccaatcaaggtttg
cgtatttttacaacgcttgatccaattgcacaaacacgcattcaagacgctttcaaagcc
tctgtcggtcagcttgccaagggtaatccatcgcgcttacgtgatttgcaaggtgctgta
ttggtctctcaccctgaaaatggggaattagttgctgccgttggctcgacacaagacttt
acaggctttaaccgtgctgtcgatgccaagcgtcaggtaggttcattacttaaacctgtc
atttacctcaatgcaattgaatctggtcgttataattgggcaagtcgtattcaagacaga
gcagtcaatgttcctactggcagtgaccaaagctggacaccgaaaaactatagtggcggt
gagcacggcgaagtcactatggcacaagcccttgccaactcttacaacttatcggcagtg
cgtttagggcaagaatttggtgtttcagcatttaccaataaattgaaaaaatttggtgtg
acctctgaaataccatcttatccatctgtgttcttgggcgcggtgaatatgtcaccgatg
gaaatgctcagtatttacagtaactttgcaacaggtggctttaagtatccaacccgcgct
attcgttctgtggtcgatgctaacggtaaggttttagagcgttttggtttaaatgttgaa
caaaccattgagccttcattggcttatgtactcaattatggcttacaacaggtcatggct
tcgggtacgggtcgctctgcatataactcgcttccaagttcacttaaactggctggaaaa
tcaggcacaaccaacgatacacgcgattcgtggtttgctggttattctggcaattacgtg
gctgtggtctggcttggcttagacaataacaaagtaacgggcttaacaggctcatcgggt
gctctacctgtatggaccaacgttatgcgtcagcttcgccagcaacccgtgaatctaaaa
cagaccgatgatgtgcagtggcaatggattgatgttgcatctggtaatttgtctgctcaa
ggctgtggcggtgcaatgtatattccaatgttgcgctctactgtgccgcaccaagcaacc
tcatgtgcttatccgtattatcaatctgcaccagtaagcgcacctatgtccgatgaagat
ccaagccaaaataatggcgataacatggatcaatacatcaatgacagtgaaaatcagatg
caagaagatctatcgcaaaataaagttatatctagcggtagctacggctattaa

DBGET integrated database retrieval system