KEGG   Acinetobacter soli: BEN76_07040Help
Entry
BEN76_07040       CDS       T04684                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
asol  Acinetobacter soli
Pathway
asol00061  Fatty acid biosynthesis
asol00780  Biotin metabolism
asol01100  Metabolic pathways
asol01212  Fatty acid metabolism
Module
asol_M00083  Fatty acid biosynthesis, elongation
asol_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:asol00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BEN76_07040
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BEN76_07040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:asol01004]
    BEN76_07040
Enzymes [BR:asol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BEN76_07040
Lipid biosynthesis proteins [BR:asol01004]
 Fatty acid synthase
  Component type
   BEN76_07040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas RnfC_N
Motif
Other DBs
NCBI-ProteinID: APV35787
UniProt: A0A1P8EHW0
LinkDB All DBs
Position
complement(1454601..1455089)
Genome map
AA seq 162 aa AA seqDB search
MMTESNTPAFTIPELPMDIQKIREYLPHRYPFLLVDRVTEVGENNIVGYKNVSINEEFFQ
GHFPNYPIMPGVLIVEALAQVAGILGFIMNNETPKPGSLFLFAGAEKVRFKKQVVAGDQL
VLKAQLVMQKRGIYKYNCIATVDGKVATTAEIIVSHLRTEQA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatgactgagtcaaacactcctgcgtttacgatccctgaattgccaatggacattcaa
aaaattcgtgaatacttaccgcaccgctatccatttcttttggtcgaccgtgtaactgaa
gtcggtgaaaataatattgtaggttataaaaacgtttcgattaacgaagagttttttcaa
ggccattttccaaactatccaattatgcctggtgttttgattgtcgaagcactggcacag
gtagcaggtattttgggtttcattatgaataatgaaacaccaaagccgggttctttgttt
ctgtttgcaggcgcagagaaagtacgttttaaaaagcaagtggttgcaggtgaccagctg
gtgttaaaagctcagcttgtgatgcaaaagcgtggtatttacaagtacaattgtatcgcg
acagttgatggtaaagtcgcaacaaccgctgaaattatagtttcacatttaagaacagag
caggcatga

DBGET integrated database retrieval system