KEGG   Acinetobacter soli: BEN76_07145Help
Entry
BEN76_07145       CDS       T04684                                 

Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
asol  Acinetobacter soli
Pathway
asol00030  Pentose phosphate pathway
asol01100  Metabolic pathways
asol01110  Biosynthesis of secondary metabolites
asol01120  Microbial metabolism in diverse environments
asol01130  Biosynthesis of antibiotics
asol01200  Carbon metabolism
asol01230  Biosynthesis of amino acids
Module
asol_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:asol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BEN76_07145
Enzymes [BR:asol01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     BEN76_07145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-ProteinID: APV35808
UniProt: A0A1P8EHY1
LinkDB All DBs
Position
complement(1476704..1477375)
Genome map
AA seq 223 aa AA seqDB search
MSLYATQDEKKQAAAKAALKHLPKGGILGVGTGSTVNFLIELLPELQLEAAVASSEATAK
RLKELGIEVLDMNHVGGLDAYVDGADEIDRHMHMIKGGGAALTREKIVASIAKKFVCIVD
DSKWVEQLGREFPLPVEVIPMARSAVARKLVSLGGDPVYREGVVTDNGNVILDVYNLNIL
NAIELEKTINDIPGVVTNGIFALNAATIAIVATNNGIEERTAS
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagtctatatgctacccaagatgagaaaaaacaagcagcagcgaaagctgctttaaaa
cacttacctaaagggggcattttaggagtgggaaccggaagtacagtcaattttctgatt
gaacttttacctgaactacagcttgaagcagcggttgccagctcggaagccacagctaaa
cgcctaaaagaattgggcattgaagtactcgacatgaaccatgtgggcggtttagacgca
tatgtcgatggtgccgacgaaattgatcgtcacatgcacatgattaaaggtggcggtgcc
gcgctcacacgtgaaaaaattgtggcctcaattgcaaagaaatttgtatgtatcgtagat
gattcaaaatgggttgaacagttgggtcgtgagttcccgttgcctgttgaagtgatccct
atggcgcgctctgctgttgcgcgtaaactggtgagccttggtggcgatcctgtttaccgt
gaaggtgtagtcacagataatggtaatgtgattttggatgtatacaacctgaatatcctc
aatgcgattgagcttgagaaaaccattaatgatattccaggtgtggtgaccaatggtatt
tttgccctaaatgctgcaaccattgcaattgttgcaacaaataacggcattgaagagcgc
acagcgtcttaa

DBGET integrated database retrieval system