KEGG   Acinetobacter soli: BEN76_08360Help
Entry
BEN76_08360       CDS       T04684                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
asol  Acinetobacter soli
Brite
Enzymes [BR:asol01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BEN76_08360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DGOK
Motif
Other DBs
NCBI-ProteinID: APV36027
UniProt: A0A1P8EIJ1
LinkDB All DBs
Position
1729296..1729982
Genome map
AA seq 228 aa AA seqDB search
MKNTLKTTLLVIAGSVMSVSAWAEFKQAPLPYATNALQPAIDQQTMELHYGKHHKAYVDN
LNAQIKTYPELDKMDPVQLQKQISKYNTAVRNNGGGHFNHTFFWESLAPANKAGQPSAAL
TKQITQDFGSMDAFKQKFNEAATGRFGSGWAWLIVTPEGKLAITSTPNQDNPLMDLAETK
GQPLLGLDVWEHAYYLKYQNRRADYIKAFWSVVNWNKVNERYMQAMKK
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatacattgaaaacaacacttttagttattgctggttcagtcatgagtgtttct
gcttgggcagaattcaaacaagcacctttgccatatgcgaccaatgcgctacaacctgct
attgatcagcaaaccatggagctacattacggcaagcaccataaagcgtatgtagacaac
ttaaatgctcaaatcaaaacctacccagaactggataaaatggatccggttcagttacaa
aagcagatttcaaaatacaatacggcggtacgtaataatggtggcggacattttaaccac
acctttttttgggagagccttgcacctgccaataaagcaggacaacctagtgcagcttta
accaaacagatcacccaagattttggctctatggatgccttcaaacaaaaattcaatgaa
gctgcaaccggacgttttggatcaggctgggcatggctgattgtgaccccagaaggaaag
ctggcgattacatcgacaccaaatcaggacaatccattgatggatctggccgaaaccaag
ggtcaacctttgttgggacttgacgtatgggaacatgcctattacttgaaataccaaaac
cgacgtgccgactatattaaagcgttttggtctgtggtgaactggaataaagtgaatgaa
cgctatatgcaagccatgaaaaaataa

DBGET integrated database retrieval system