KEGG   Acinetobacter soli: BEN76_12345Help
Entry
BEN76_12345       CDS       T04684                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
asol  Acinetobacter soli
Pathway
asol00471  D-Glutamine and D-glutamate metabolism
asol00550  Peptidoglycan biosynthesis
asol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BEN76_12345
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BEN76_12345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:asol01011]
    BEN76_12345
Enzymes [BR:asol01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     BEN76_12345
Peptidoglycan biosynthesis and degradation proteins [BR:asol01011]
 Precursor biosynthesis
  Amino acid ligase
   BEN76_12345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-ProteinID: APV36759
UniProt: A0A1P8EKM0
LinkDB All DBs
Position
complement(2610069..2611523)
Genome map
AA seq 484 aa AA seqDB search
MSPTTPADQAKKLIKVPEMRRIKHIYFVGIGGAGMCGIAEVLKNQGYKISGSDIKASKTT
AQLEEKGVKVYIGHSAENLKAVDVLVVSTAIDQENPEIKAAMEQRIPVVRRAEMLGELMR
YRHGIAVAGTHGKTTTTSLLTTMLAEENLDPTYVIGGLLNRTGVNAALGASRFIVAEADE
SDASFLYLQPMAAIITNVDADHMDTYGGSFDKLKDTFVEFIHRLPFYGLAVVCGDDQNVR
EIMPRFGRPTLTYGFNEDNDIRAVDVVQEGMQSHFTVLRKDREPLRLTVNQPGLHNILNA
LAAIGVATDEGVSDAAIGRALEGFSGVGRRFQVQGEYALGDGDVKLVDDYGHHPKEVEAT
IKAARQSHPDRRLVMMFQPHRYSRTRDCFDDFVEVLSQVDQLLLLEVYPAGEKPIVGADS
RALARSIRLRGDVEPILVDPVEGNLPNIIQKVLQANDLLLTQGAGNVGAISVDLAQQHLY
LKSV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccaacaaccccagccgatcaagccaaaaaactcattaaagttcctgagatgcgc
cgtattaaacacatttattttgtgggaatcggtggtgctgggatgtgcggcattgcagaa
gttttaaaaaaccaagggtataaaatatctggctcagatatcaaagcctctaaaaccacg
gcacagcttgaagaaaaaggcgtaaaagtttatatcggacacagtgccgaaaacctgaaa
gctgtagatgtactggtggtatcgacagccatcgatcaggaaaaccctgaaattaaagca
gcgatggagcagcgtattcctgtggtgcgccgtgcagaaatgctgggtgagctgatgcgc
taccgtcatgggattgcagttgcaggcacgcatggtaaaaccacaaccaccagcttgctg
accaccatgttggccgaagaaaatctggatccgacttatgtgattggcggtttgctcaat
cgtaccggagtgaatgctgcgctcggtgcaagtcgctttattgtggccgaagctgatgaa
tccgacgcctcatttttatatttgcaaccaatggccgccattattaccaatgtcgatgcg
gaccatatggatacctacggtggaagcttcgacaaattaaaagatacctttgtcgagttt
attcatcgtttaccgttttacggtttggctgtggtgtgtggcgatgatcagaatgtgcgt
gaaatcatgccacgttttggccgtccaaccttgacctatggttttaatgaagacaacgat
attcgtgctgtagacgtggtgcaagaaggcatgcagtcgcattttaccgtattgcgaaaa
gatcgcgaaccattgcgtctgacggttaatcagccagggctgcacaacattttaaatgca
cttgcagcgattggtgtggccaccgatgaaggggtttccgatgcagcgattggtcgtgcg
ctagaaggttttagtggtgttggacgccgttttcaggtgcaaggtgaatatgcacttggt
gatggagatgtcaaactggtcgatgattatggccaccatccaaaagaagtcgaagccacc
attaaagcggcccgccaaagccatccagatcgtcgtctggtcatgatgtttcaaccgcat
cgttacagccgtacccgtgactgtttcgatgattttgtagaagtgctgtcacaggtggac
caactgctgttgctcgaagtttaccctgcgggtgaaaagccgattgttggtgccgacagc
cgcgccttggcacgaagtatccgcttacgtggtgatgtagagcctattttggtcgatccg
gttgaaggcaatttgcccaacatcatacaaaaagtgttacaagcaaatgacttgttattg
acgcaaggtgcgggtaacgtgggagcaatttcagtcgatcttgcccagcagcatttgtat
ttaaaatcagtgtaa

DBGET integrated database retrieval system